[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21934.1

[Show Plain Result]


## Summary of Sequence Search
    1::247
    5::238     5e-28  30%  248 aa  TRMHL_STAAE RecName: Full=Putative trmH family tRNA/rRNA
    5::238     5e-28  30%  248 aa  TRMHL_STAAC RecName: Full=Putative trmH family tRNA/rRNA
    1::245     7e-28  29%  249 aa  YACO_BACSU RecName: Full=Putative trmH family tRNA/rRNA
    5::238     3e-27  30%  248 aa  TRMHL_STAAW RecName: Full=Putative trmH family tRNA/rRNA
    5::238     3e-27  30%  248 aa  TRMHL_STAAS RecName: Full=Putative trmH family tRNA/rRNA
    5::238     3e-27  30%  248 aa  TRMHL_STAAR RecName: Full=Putative trmH family tRNA/rRNA
    5::238     3e-27  30%  248 aa  TRMHL_STAAN RecName: Full=Putative trmH family tRNA/rRNA
    5::238     3e-27  30%  248 aa  TRMHL_STAAM RecName: Full=Putative trmH family tRNA/rRNA
    5::243     5e-26  30%  249 aa  TRMHL_STAHJ RecName: Full=Putative trmH family tRNA/rRNA
    5::243     2e-25  28%  249 aa  TRMHL_STAS1 RecName: Full=Putative trmH family tRNA/rRNA
    5::243     9e-25  28%  249 aa  TRMHL_STAES RecName: Full=Putative trmH family tRNA/rRNA
    5::243     9e-25  28%  249 aa  TRMHL_STAEQ RecName: Full=Putative trmH family tRNA/rRNA
  125::360     8e-24  30%  384 aa  Y955_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA
    7::235     1e-23  30%  248 aa  RLMB_PSEAE RecName: Full=23S rRNA
    7::240     3e-23  29%  250 aa  RLMB_COXBU RecName: Full=23S rRNA
    5::234     5e-23  30%  246 aa  RLMB_HAEIN RecName: Full=23S rRNA
    2::233     9e-23  30%  243 aa  RLMB_SHIFL RecName: Full=23S rRNA
    2::233     9e-23  30%  243 aa  RLMB_ECOLI RecName: Full=23S rRNA
    2::233     9e-23  30%  243 aa  RLMB_ECOL6 RecName: Full=23S rRNA
    2::233     9e-23  30%  243 aa  RLMB_ECO57 RecName: Full=23S rRNA
    2::235     1e-22  28%  246 aa  RLMB_SHEON RecName: Full=23S rRNA
    7::235     1e-22  28%  250 aa  RLMB_NEIMB RecName: Full=23S rRNA
    1::237     1e-22  27%  249 aa  RLMB_XYLFA RecName: Full=23S rRNA
    5::234     1e-22  29%  246 aa  RLMB_HAEDU RecName: Full=23S rRNA
    2::233     3e-22  30%  243 aa  RLMB_SALTY RecName: Full=23S rRNA
    7::235     3e-22  28%  250 aa  RLMB_NEIMA RecName: Full=23S rRNA
    2::233     7e-22  29%  243 aa  RLMB_SALTI RecName: Full=23S rRNA
    2::233     1e-21  29%  246 aa  RLMB_YERPE RecName: Full=23S rRNA
    5::234     1e-21  28%  245 aa  RLMB_PASMU RecName: Full=23S rRNA
    2::233     2e-21  29%  244 aa  RLMB_ERWCT RecName: Full=23S rRNA
    2::233     3e-21  28%  244 aa  RLMB_PHOLL RecName: Full=23S rRNA
    1::237     4e-21  27%  249 aa  RLMB_XYLFT RecName: Full=23S rRNA
    2::234     8e-21  29%  247 aa  RLMB_VIBPA RecName: Full=23S rRNA
    2::234     8e-21  28%  245 aa  RLMB_PHOPR RecName: Full=23S rRNA
    2::234     1e-20  29%  247 aa  RLMB_VIBCH RecName: Full=23S rRNA
    2::234     2e-20  28%  247 aa  RLMB_VIBVY RecName: Full=23S rRNA
    2::234     2e-20  28%  247 aa  RLMB_VIBVU RecName: Full=23S rRNA
    7::235     5e-20  29%  248 aa  RLMB_PSEPK RecName: Full=23S rRNA
    6::235     9e-20  27%  248 aa  RLMB_CHRVO RecName: Full=23S rRNA
    7::235     2e-19  28%  250 aa  RLMB_PSESM RecName: Full=23S rRNA
    1::237     7e-18  26%  249 aa  RLMB_XANAC RecName: Full=23S rRNA
   24::235     3e-17  32%  254 aa  RLMB_BLOFL RecName: Full=23S rRNA
   70::304     4e-17  25%  309 aa  Y479_MYCPA RecName: Full=Uncharacterized tRNA/rRNA
  170::311     6e-17  28%  315 aa  Y572_MYCA9 RecName: Full=Uncharacterized tRNA/rRNA
    3::237     7e-17  23%  245 aa  RLMB_BORPE RecName: Full=23S rRNA
    3::237     7e-17  23%  245 aa  RLMB_BORPA RecName: Full=23S rRNA
    3::237     7e-17  23%  245 aa  RLMB_BORBR RecName: Full=23S rRNA
    7::234     9e-17  26%  260 aa  RLMB_NITEU RecName: Full=23S rRNA
    1::234     2e-16  27%  249 aa  RLMB_RALSO RecName: Full=23S rRNA
  173::314     4e-16  27%  314 aa  Y6073_MYCS2 RecName: Full=Uncharacterized tRNA/rRNA
   36::236     4e-16  28%  242 aa  Y252_MYCGE RecName: Full=Uncharacterized tRNA/rRNA
   53::223     1e-15  34%  224 aa  Y2399_ARCFU RecName: Full=Uncharacterized tRNA/rRNA
   72::314     1e-15  24%  314 aa  Y1447_MYCGI RecName: Full=Uncharacterized tRNA/rRNA
   72::314     1e-15  24%  314 aa  Y5337_MYCVP RecName: Full=Uncharacterized tRNA/rRNA
  375::523     3e-15  31%  531 aa  MRM1_DICDI RecName: Full=Mitochondrial rRNA methyltransferase;     
   28::246     4e-15  27%  248 aa  YSGA_BACSU RecName: Full=Uncharacterized tRNA/rRNA
    7::221     1e-14  24%  228 aa  Y516_BORBU RecName: Full=Uncharacterized tRNA/rRNA
   85::236     1e-13  26%  242 aa  Y355_MYCPN RecName: Full=Uncharacterized tRNA/rRNA
   70::304     2e-13  23%  309 aa  Y574_MYCA1 RecName: Full=Uncharacterized tRNA/rRNA
    1::237     2e-13  24%  249 aa  RLMB_XANCP RecName: Full=23S rRNA
  169::305     2e-12  25%  310 aa  Y5079_MYCMM RecName: Full=Uncharacterized tRNA/rRNA
  169::305     2e-12  25%  310 aa  Y4155_MYCUA RecName: Full=Uncharacterized tRNA/rRNA
   27::299     7e-12  32%  301 aa  MRM1_SCHPO RecName: Full=rRNA methyltransferase, mitochondrial;    
  147::308     2e-11  27%  353 aa  MRM1_HUMAN RecName: Full=rRNA methyltransferase 1, mitochondrial;  
   73::314     2e-11  23%  314 aa  Y5122_MYCSJ RecName: Full=Uncharacterized tRNA/rRNA
   73::314     2e-11  24%  314 aa  Y4822_MYCSK RecName: Full=Uncharacterized tRNA/rRNA
   73::314     2e-11  24%  314 aa  Y4736_MYCSS RecName: Full=Uncharacterized tRNA/rRNA
  228::408     6e-11  33%  412 aa  MRM1_YEAST RecName: Full=rRNA methyltransferase, mitochondrial;    
  105::240     1e-10  29%  248 aa  RLMB_ACIAD RecName: Full=23S rRNA
   70::304     2e-10  22%  309 aa  Y324_MYCLE RecName: Full=Uncharacterized tRNA/rRNA
   70::304     2e-10  22%  309 aa  Y324_MYCLB RecName: Full=Uncharacterized tRNA/rRNA
  200::335     3e-10  26%  345 aa  YFIF_ECOLI RecName: Full=Uncharacterized tRNA/rRNA
  200::335     3e-10  26%  345 aa  YFIF_ECO57 RecName: Full=Uncharacterized tRNA/rRNA
  168::304     4e-09  23%  322 aa  Y3618_MYCTA RecName: Full=Uncharacterized tRNA/rRNA
  168::304     4e-09  23%  322 aa  Y3579_MYCTU RecName: Full=Uncharacterized tRNA/rRNA
  168::299     6e-09  24%  322 aa  Y3644_MYCBP RecName: Full=Uncharacterized tRNA/rRNA
  168::299     9e-09  24%  402 aa  Y3610_MYCBO RecName: Full=Uncharacterized tRNA/rRNA
  106::275     3e-08  21%  288 aa  Y905_MYCBO RecName: Full=Uncharacterized tRNA/rRNA
  106::275     5e-08  21%  288 aa  Y881_MYCTU RecName: Full=Uncharacterized tRNA/rRNA
   69::234     8e-08  26%  247 aa  RLMB_BURSP RecName: Full=23S rRNA
   16::156     1e-07  29%  166 aa  Y521_MYCPN RecName: Full=Uncharacterized tRNA/rRNA
   22::168     9e-07  23%  229 aa  TRMH_SHIFL RecName: Full=tRNA guanosine-2'-O-methyltransferase;    
   22::168     9e-07  23%  229 aa  TRMH_ECOLI RecName: Full=tRNA guanosine-2'-O-methyltransferase;    
   22::168     9e-07  23%  229 aa  TRMH_ECO57 RecName: Full=tRNA guanosine-2'-O-methyltransferase;    
   16::156     1e-06  27%  166 aa  Y346_MYCGE RecName: Full=Uncharacterized tRNA/rRNA
   13::145     2e-06  23%  157 aa  YGL3_BACST RecName: Full=Uncharacterized tRNA/rRNA
  145::221     4e-06  26%  320 aa  MRM1_MOUSE RecName: Full=rRNA methyltransferase 1, mitochondrial;  
  125::261     6e-06  18%  274 aa  Y1673_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA
  119::258     1e-05  27%  270 aa  TSNR_STRLU RecName: Full=rRNA (adenosine-2'-O-)-methyltransferase; 
  120::282     2e-05  22%  351 aa  Y424_HAEIN RecName: Full=Uncharacterized tRNA/rRNA
 1458::1604    2e-05  24% 1621 aa  TARB1_HUMAN RecName: Full=Probable methyltransferase TARBP1;       
   33::184     5e-05  24%  218 aa  Y052_BORBU RecName: Full=Putative tRNA/rRNA methyltransferase
  119::258     5e-05  27%  269 aa  TSNR_STRCN RecName: Full=rRNA (adenosine-2'-O-)-methyltransferase; 
    1::247

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNKSSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTSKDQI
TRMHL_STAAE     ------VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLANAP--
TRMHL_STAAC     ------VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLANAP--
YACO_BACSU      MSQQHDYVIGKNAVIETLKSD-RKLYKLWMAENTVKGQAQQVIELAKKQGITIQYVPRKKLDQMVTGQHQ
TRMHL_STAAW     ------VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLANAP--
TRMHL_STAAS     ------VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLANAP--
TRMHL_STAAR     ------VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLANAP--
TRMHL_STAAN     ------VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLANAP--
TRMHL_STAAM     ------VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLANAP--
TRMHL_STAHJ     ------VIVGRHAVKEAIVSG-HTINKIWIQEGI-----RKQQINDILQNAKVQTVPKSKLDNLANAP--
TRMHL_STAS1     ------VIVGRHAVKEAIVSG-HTINKILIQDTIKKGQINEILKLANSNKIIVQSVPKSKIDGLSDSPHQ
TRMHL_STAES     ------VIVGRHAVKEAIISG-HAINKILIQDGIKKQQINDILKNAKSQKLIVQTVPKSKLDFLANAP--
TRMHL_STAEQ     ------VIVGRHAVKEAIISG-HAINKILIQDGIKKQQINDILKNAKSQKLIVQTVPKSKLDFLANAP--
Y955_SYNY3      ------LLYGHHAVLAAL-DGDRQLNRIWITSHLRHDIRYRTK----IQTAKANGTVVDEVDNFRL-NQI
RLMB_PSEAE      -------VYGVHAVEALLRHHPKRVKQLWLAEG------RHDPRVQVLTELAAGFRDRRELDEWAEG---
RLMB_COXBU      -------IYGIHAVSGVLDAAPQRIVKLYVQENRDDQRLQSLVEKAKALGVKVILLSRTELNTLSNEK--
RLMB_HAEIN      -------IYGIHAVNSILTHSPERLIEVFVLKGREDK--RLQPLLNELYSIGVQFVNRQTLDK--KADGE
RLMB_SHIFL      ----SEMIYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESVVIQLANRQYLDE--KSDGA
RLMB_ECOLI      ----SEMIYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESVVIQLANRQYLDE--KSDGA
RLMB_ECOL6      ----SEMIYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESVVIQLANRQYLDE--KSDGA
RLMB_ECO57      ----SEMIYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESVVIQLANRQYLDE--KSDGA
RLMB_SHEON      --KKQDIIFGIHAVEALLKHSPERIIELWLLQGREDERLTPLIRQAKAFGTSIQVTSRKVLDEKAESTQ-
RLMB_NEIMB      -------IYGFHAVNARLWQNPKSIVELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAISARHQG
RLMB_XYLFA      MNKKNQWIVGINAVVSSIENDAEHVCEV-LVEAGSKNSRLLDIEENARKGIEVRRVTTQALDGVGGG--V
RLMB_HAEDU      -------IYGIHAVNAFLANAPERLIEVFVLKGREDK--RLNPLLDELQSISVQQVNRQTLDNKAQGE--
RLMB_SALTY      ----SEMIYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESVVIQLANRQYLDE--KSDGA
RLMB_NEIMA      -------IYGFHAVNARLWQNPKSIVELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAISARHQG
RLMB_SALTI      ----SEMIYGIHAVQALLERAPERFQEAFILKGREDK--RLLPLIHALESVVIQLANRQYLDE--KSDGA
RLMB_YERPE      ----SEIIYGIHAVKALLERDPQRFLEVFILKG--RDDRRLQPLIAELEGLVIQVASRQWLDSQVEGG--
RLMB_PASMU      -------IYGIHAVSAFLNNAPERLIEVYALKG--RDDKRLQPLLNELHGITIQFVNRQTLDKKAEGE--
RLMB_ERWCT      ----SEIIYGIHAVKALLERDPQRFLEVFILKG--RDDRRLQPVIAELEGIVIQVASRQWLDKQA--EDA
RLMB_PHOLL      ----SEIIYGIHAVKALLERDPQRFIEVYVLKGREDR--RLTPLIHALESITIQLANRQWLDNQT--EGA
RLMB_XYLFT      MNKKNQWIVGINAVVSSIENDAEHVREV-LVEAASKNSRLLDIEENARKGIEVRRVTTQALDGVGGG--V
RLMB_VIBPA      ---SNEFIYGIHAVKAVLEREPERFIEAYVLKGRQDD--RLMP---ILNDLQVCGVSIQQMTRKTLDDKA
RLMB_PHOPR      ---SNDMIFGIHAVKAVLATDPVRLIEVFVLKDRQDD--RLMPLLTELKDITIQHAGRKALDDKAKGAS-
RLMB_VIBCH      ---SNELIYGIHAVNAVLQRDPARFVEAYVLKGRQDD--RLLPVLNELMGVSIQEMSRKALDD--KAEGA
RLMB_VIBVY      ---SNEFIYGIHAVRAVLDKEPERFIEAYVLKGRQDD--RLMPILNELQMVGV---SLQQMTRKTLDDKA
RLMB_VIBVU      ---SNEFIYGIHAVRAVLDKEPERFIEAYVLKGRQDD--RLMPILNELQMVGV---SLQQMTRKTLDDKA
RLMB_PSEPK      -------IYGVHAVQALLQHHPKRVKQIWLSEG------RSEPRLETLNRVPVGQAERREMDAWVEG---
RLMB_CHRVO      ------LIHGFHAINARLWQNPKSLIEIWLAGGRHDARAKAVLDKAGAENVKLHIVDKERLDSMSGNAR-
RLMB_PSESM      -------IYGVHAVEALLRHHPKRVKHIWLAEG------RNDPRVQTLNRVTIGQAERREMDAWVEG---
RLMB_XANAC      MSKQNQWIVGVNAVASSVENDADNVREVLIEAGSK------NPRLTEIEEQA----RRKGIDVRRVNTQA
RLMB_BLOFL      -------------IVYIVSNPRDLRLKSLIYRIRKMNINIQECTRRVLN-----IKSMKSA---------
Y479_MYCPA      -------VLGRNPVLECLRGVPATALYVALGTEADERL-TESVSRAADSGISILEVPRADLDRMTGNH--
Y572_MYCA9      ----------------------------------------------------------------------
RLMB_BORPE      ---STQVLAGFHAVVARLRHAPESIKEIYVEASRRDKRMQTFLEQAERAGRRVHPVAAERLDGLARGTR-
RLMB_BORPA      ---STQVLAGFHAVVARLRHAPESIKEIYVEASRRDKRMQTFLEQAERAGRRVHPVAAERLDGLARGTR-
RLMB_BORBR      ---STQVLAGFHAVVARLRHAPESIKEIYVEASRRDKRMQTFLEQAERAGRRVHPVAAERLDGLARGTR-
RLMB_NITEU      -------IFGFHAITSRLRQHPDSIKEIYL--DTNRHDQRARDLMSLAESTRLILCEQDRLCKMTGTTR-
RLMB_RALSO      MSKSK-LLIGFHAVTARLRHDARSIDEIYFEANRRDRRMQDFLKAAEAAGVRMIPADNERLRGIAGTDR-
Y6073_MYCS2     ----------------------------------------------------------------------
Y252_MYCGE      ----------------------KKLIPLIEAKKINFQIHSTNWFNNQYRDI-----NHQELVAVLDTNQL
Y2399_ARCFU     ----------------------------------------------------------------------
Y1447_MYCGI     ------IVLGRNPVVECLRGVPATALYVALGTDADERL-TESVQMAADRGISILEVQRHDLDRMAANG--
Y5337_MYCVP     ------IVLGRNPVLECLRGVPATALYVALGADSDERL-TESVQIAADKGIAILEVPRHDLDRIAANG--
MRM1_DICDI      ----------------------------------------------------------------------
YSGA_BACSU      ---NTFLIEGEHLVEEALKSPG--IVKEILVKDETRI------PSDLETGIQCYMLSE---DAFSAVTET
Y516_BORBU      ---------------------------------------KKSPKTKEIENIKIIRINTNELDKILKNKD-
Y355_MYCPN      ----------------------------------------------------------------------
Y574_MYCA1      -------VLGRNPVLECLRGVPATALYVALGTEADERL-TESVSRAADSGISILEVPRADLDRMTGNH--
RLMB_XANCP      MSKQNQWIVGVNAVASSVENDADNVREVLIEAGSK------NPRLTEIEEIDVRRVNTQALDGVGG--QV
Y5079_MYCMM     ----------------------------------------------------------------------
Y4155_MYCUA     ----------------------------------------------------------------------
MRM1_SCHPO      IKEDSEFVFGTHSVKNALATRKRECRALYVQEEFLNKLQYKIPIKSV---------NKEHLNQITACRP-
MRM1_HUMAN      ----------------------------------------------------------------------
Y5122_MYCSJ     ------LVLGRNPVVECLRAPATALYVAMGTEADE----RVTEAVQIAADSGISILEVPRSDLDRMSNNA
Y4822_MYCSK     ------LVLGRNPVVECLRAPATALYVAMGTEADE----RVTEAVQIAADISILEVPRSDLDRMSNN--A
Y4736_MYCSS     ------LVLGRNPVVECLRAPATALYVAMGTEADE----RVTEAVQIAADISILEVPRSDLDRMSNN--A
MRM1_YEAST      ----------------------------------------------------------------------
RLMB_ACIAD      ----------------------------------------------------------------------
Y324_MYCLE      -------VLGRNPVLECLRAPATALYVALGTEVDKRLTESVMRAADV--GVAILEVPRTYLDRITNNH--
Y324_MYCLB      -------VLGRNPVLECLRAPATALYVALGTEVDKRLTESVMRAADV--GVAILEVPRTYLDRITNNH--
YFIF_ECOLI      ----------------------------------------------------------------------
YFIF_ECO57      ----------------------------------------------------------------------
Y3618_MYCTA     ----------------------------------------------------------------------
Y3579_MYCTU     ----------------------------------------------------------------------
Y3644_MYCBP     ----------------------------------------------------------------------
Y3610_MYCBO     ----------------------------------------------------------------------
Y905_MYCBO      ----------------------------------------------------------------------
Y881_MYCTU      ----------------------------------------------------------------------
RLMB_BURSP      ----------------------------------------------------------------------
Y521_MYCPN      ----------------------------------------------------------------------
TRMH_SHIFL      ----------------------------------------------------------------------
TRMH_ECOLI      ----------------------------------------------------------------------
TRMH_ECO57      ----------------------------------------------------------------------
Y346_MYCGE      ----------------------------------------------------------------------
YGL3_BACST      ----------------------------------------------------------------------
MRM1_MOUSE      ----------------------------------------------------------------------
Y1673_SYNY3     ----------------------------------------------------------------------
TSNR_STRLU      ----------------------------------------------------------------------
Y424_HAEIN      -------VYGENACLALFAERPESIVRLWATVQMSHKIGEV--LSYLAENKKAYHVDSEELARVSGTEH-
TARB1_HUMAN     ----------------------------------------------------------------------
Y052_BORBU      ----------------------------------------------------------------------
TSNR_STRCN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MHGGYIAEVEHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLM
TRMHL_STAAE     -HQGVAALIAPYEYADFDQFLKQQKELTVLILDGLEDPHNLGSILRTADATGVDGVIIPKRRSVTLTQTV
TRMHL_STAAC     -HQGVAALIAPYEYADFDQFLKQQKELTVLILDGLEDPHNLGSILRTADATGVDGVIIPKRRSVTLTQTV
YACO_BACSU      GXXXXXXXXXXXXLDDLYKAAEEKNEQPFFLIDELEDPHNLGSIMRTADAVGAHGIVIPKRRAVGLTTTV
TRMHL_STAAW     -HQGVAALIAPYEYADFDQFLKQQKEKTVLILDGLEDPHNLGSILRTADATGVDGVIIPKRRSVTLTQTV
TRMHL_STAAS     -HQGVAALIAPYEYADFDQFLKQQKEKTVLILDGLEDPHNLGSILRTADATGVDGVIIPKRRSVTLTQTV
TRMHL_STAAR     -HQGVAALIAPYEYADFDQFLKQQKEKTVLILDGLEDPHNLGSILRTADATGVDGVIIPKRRSVTLTQTV
TRMHL_STAAN     -HQGVAALIAPYEYADFDQFLKQQKEKTVLILDGLEDPHNLGSILRTADATGVDGVIIPKRRSVTLTQTV
TRMHL_STAAM     -HQGVAALIAPYEYADFDQFLKQQKEKTVLILDGLEDPHNLGSILRTADATGVDGVIIPKRRSVTLTQTV
TRMHL_STAHJ     -HQGVAALIAPYEYADFDQFIQSQKDKTVVILDGLEDPHNLGSILRTADASGVDGVIIPKRRSVALTQTV
TRMHL_STAS1     GVAAYIAPYEYADFDAFVAQQKAQDKLSTVLIDGLEDPHNLGSILRTADASGVDGVIIPKRRSVALTQTV
TRMHL_STAES     -HQGVAALVAPYEYANFDEFLQKQKKKTVIILDGLEDPHNLGSILRTADASGVDAVIIPKRRSVALTQTV
TRMHL_STAEQ     -HQGVAALVAPYEYANFDEFLQKQKKKTVIILDGLEDPHNLGSILRTADASGVDAVIIPKRRSVALTQTV
Y955_SYNY3      THNGIAAQVAPYHYWELGDLIKAKSQSTLIIIDSITDPHNLGAIIRTAEAFGAQGMVLPQRRVAGITSTV
RLMB_PSEAE      VHQGVVAEVSPSQENMLEELLERSEGVPLLALDGVTDPHNLGACLRTADAAGVQAVIVPKDKSATLNATV
RLMB_COXBU      -HQGIVAEVENLDESALLSLLKKRETPALLLIDGVKDPHNLGACLRSANAFGVRAVIAPKDRAVGVTPVV
RLMB_HAEIN      VHQGVIARVQELNENDLDEILANKQNPLLLVLDGVTDPHNLGACLRTADAAGAVAVIVPKDKSAQLTSIA
RLMB_SHIFL      VHQGIIARVKQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATA
RLMB_ECOLI      VHQGIIARVKQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATA
RLMB_ECOL6      VHQGIIARVKQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATA
RLMB_ECO57      VHQGIIARVKQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATA
RLMB_SHEON      -HQGIVARVKALAEHDLDELL-AKTDLPFLLIDGVTDPHNLGACLRNADAAGVQGIIVPKDNSVGLTAVV
RLMB_NEIMB      VVGFIDASKNHVHLEDVLENLSEPPLL--LILDGITDPHNLGACLRTADAMGVHAVIAPKDKSAGLNATV
RLMB_XYLFA      RHQGVAARYAAVEEHDLKDLVDAAGQALLLVLDGVQDPHNLGACLRSAAAAGVTAVIIPKDKSVGINATV
RLMB_HAEDU      VHQGIIARIKELNEYDLNELLQHKSNPLLLILDGVTDPHNLGACLRTADAAGVDAVIVPKDKSATLTAIA
RLMB_SALTY      VHQGIIARVKQYQENDLPDLIALHDRPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATA
RLMB_NEIMA      VVGFIDASKNHVHLEDVLENLSEPPLL--LILDGITDPHNLGACLRTADAMGVHAVIAPKDKSAGLNATV
RLMB_SALTI      VHQGIIARVKQYQENDLPDLIALHDRPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATA
RLMB_YERPE      VHQGIVARVREYQENDLPALLESVETPFLLVLDGVTDPHNLGACLRSADAAGVHAVIVPRDRSAQLNAIA
RLMB_PASMU      VHQGIMARVQELNEADLDTLLQNQSNPLLLVLDGVTDPHNLGACLRTADAAGVCAVIVPKDKSAQLTAIA
RLMB_ERWCT      VHQGIVAKVKEYQENDLPAMLDNLEMPFLLILDGVTDPHNLGACLRNADGAGVHAVIVPRDRSAQLNATV
RLMB_PHOLL      VHQGIIAKVKQYQENDLPDLLAQVETPFLLVLDGVTDPHNLGACLRSADAAGVHAVIIPRDRSAQLNATA
RLMB_XYLFT      RHQGVAARYAAVEEHDLKDLVDAAGQALLLVLDGVQDPHNLGACLRSAAAAGVTAVIIPKDKSVGINATV
RLMB_VIBPA      HHQGIIARVKQLNENDIDDILAQHETPLLLVLDGVTDPHNLGACLRNADAAGVAAIIVKDRSAPMNATVS
RLMB_PHOPR      -HQGIIARVKQLNEHDLDTILEGSENPLLLILDGVTDPHNLGACLRNADAAGAVAVIIPKDRAAQLTATA
RLMB_VIBCH      NHQGLIARVKQLNENDLDDILAQHEQPLLLVLDGVTDPHNLGACLRNADAAGVAAVIVPKDKSAPLTATV
RLMB_VIBVY      HHQGIIARVKQLNENDLDDILAKHASPLLLILDGVTDPHNLGACLRNADAAGVAAVIVPKDKSAPMTATV
RLMB_VIBVU      HHQGIIARVKQLNENDLDDILAKHASPLLLILDGVTDPHNLGACLRNADAAGVAAVIVPKDKSAPMTATV
RLMB_PSEPK      VHQGVVAEVSPSQXXXXXXXXXXXXXXXILVLDGVTDPHNLGACLRTADAAGATAVIVPKDKSATLTPVV
RLMB_CHRVO      -HQGVVAMIDSMNYVDLDDVLENLSEPPLLLIDGVTDPHNLGACLRVADAMGAHAVIAPKDRSATLNATV
RLMB_PSESM      VHQGVVADVSPSQEAMLDELLRSEGPPLLLVLDGVTDPHNLGACLRTADAAGALAVIVPKDKSATLTPAV
RLMB_XANAC      LDGGGQVRHQGVXXXXXXXXXXXENELEVLILDGVQDPHNLGACLRSAAAAGVTAVVIPKDKSATVNATV
RLMB_BLOFL      -HQGIIAEV--IPMPALNEFLKTKNNIILLVLDGITDPHNLGACIRSADAAGVHMIIVPRDRSANVNATV
Y479_MYCPA      LHQGIALQVPYAHPDDLLEAAAGSLPALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVA
Y572_MYCA9      -----------------------------VALDNISDPRNLGAIVRSVAAFGGHGVVIPQRRSASVTAVA
RLMB_BORPE      -HQGVVAVAEEVGIDEVLDVIEGPALL--LILDGVTDPHNLGACLRTADAAGVHAVIAPRDRAVGLNATV
RLMB_BORPA      -HQGVVAVAEEVGIDEVLDVIEGPALL--LILDGVTDPHNLGACLRTADAAGVHAVIAPRDRAVGLNATV
RLMB_BORBR      -HQGVVAVAEEVGIDEVLDVIEGPALL--LILDGVTDPHNLGACLRTADAAGVHAVIAPRDRAVGLNATV
RLMB_NITEU      -HQGVAAHVTKLRRYATLEXXXXXXXXXXXXXDGVKDPHNLGACLRVADAFGVHAVVVPKDRAVGLSATV
RLMB_RALSO      -HQGVVAKXXXXXXXXXXXXIEGPPLL--LVLDGVTDPHNLGACLRVXXXXXXXXXXXPKDRSVGINTTV
Y6073_MYCS2     ----------------------------------ISDPRNLGAIVRSVAAFAGHGVVIPQRRSASVTAVA
Y252_MYCGE      L----------IPLDQLVKVVENKKCSTLVMLDEIQDPYNFGAILRTCLASEVDGIIFKKNQVPINNTVM
Y2399_ARCFU     ----FSAEVSPIKYADFEFIVKGGSFILF--LDNVVDQRNIGACIRTAEFFGAAGVVLPKRRVGSIQEGA
Y1447_MYCGI     LHQGIALQVPPYAHPDLRDAKSDAAPALLVALDNISDPRNLGAIVRSVAAFGGHGVVLPQRRSASVTAVA
Y5337_MYCVP     MHQGIALQVPPYNHPDLAEAKSDAMPALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVA
MRM1_DICDI      ----------------------------WLVLDELWDPQNVGAIIRNCSFFNIDGVVISNKNSSPITPAA
YSGA_BACSU      ETPQQIAAVCHMPEEKLATARK------VLLIDAVQDPGNLGTMIRTADAAGLDAVVLGDGTADAFNGKT
Y516_BORBU      -HRGFAXXTQTKDFENLLETFKKKENAFILLLDEIEDPQNFGAILRTAEQFSIDLVITTQKRSAKDNSTV
Y355_MYCPN      ----------------LIQITDSKSTSTLVMLHEIQDPHNFGAILRTCMAAEVDGIIFKKHNQAPINSTV
Y574_MYCA1      LHQGIALQVPYAHPDDLLEAAAGSPPALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVA
RLMB_XANCP      RHQGVXXXXXXXXENELEGLVEAAQGRALVLIDGVQDPHNLGACLRSAAAAGVTAVVIPKDKSATVNATV
Y5079_MYCMM     ----------------------------------ISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVA
Y4155_MYCUA     ----------------------------------ISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVA
MRM1_SCHPO      -HNGVVLEASSLNVPTISDLLEGKSSSSYVYVDGITDPQNMGAVIRSAYILGAKGILLSKKHNTFLSPVV
MRM1_HUMAN      ----------------------------WLVLDGIQDPRNFGAVLRSAHFLGVDKVITSRRNSCPLTPVV
Y5122_MYCSJ     LHQGLGLQVPPYDYADLLATAKADGAALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVA
Y4822_MYCSK     LHQGLGLQVPPYDYADLLATAKADGAALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVA
Y4736_MYCSS     LHQGLGLQVPPYDYADLLATAKADGAALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVA
MRM1_YEAST      -------ELPYGTKTDAKKFPLG------LYLDEITDPHNIGAIIRSAYFLGVDFIVMSRRNCSPLTPVV
RLMB_ACIAD      ----------------------------------VTDPHNLGACIRTAAAMGIAAVIVPRDRSASLTPTA
Y324_MYCLE      LHQGIALQVHYVHSDDLLAAATDSPPALLVALDNISDPRNLGAIVRSVAAFSGHGILIPQRRSASVTAVA
Y324_MYCLB      LHQGIALQVHYVHSDDLLAAATDSPPALLVALDNISDPRNLGAIVRSVAAFSGHGILIPQRRSASVTAVA
YFIF_ECOLI      -----------------------------LALENESNPHNLGGMMRSCAHFGVKGVVVQDAAL-LESGAA
YFIF_ECO57      -----------------------------LALENESNPHNLGGMMRSCAHFGVKGVVVQDAAL-LESGAA
Y3618_MYCTA     ----------------------------------LSDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVA
Y3579_MYCTU     ----------------------------------LSDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVA
Y3644_MYCBP     ----------------------------------LSDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVA
Y3610_MYCBO     ----------------------------------LSDPRNLGAIMRSVAAFGGHGVLIPQRRSASVTAVA
Y905_MYCBO      LNRGVLAAARRVPEPSVAQVVAGAR--TVAVLEGVNDHENLGSIFRNAAGLSVDAVVFGTGCADPLYRRA
Y881_MYCTU      LNRGVLAAAGRVPEPSVAQVVAGAR--TVAVLEGVNDHENLGSIFRNAAGLSVDAVVFGTGCADPLYRRA
RLMB_BURSP      -HQGVVARVTEATRAHLLDTIEGQPLL--LALDGVTDPHNLGACLRVADGAGAHAVIXXXXXXXXXXXXX
Y521_MYCPN      -------------------------------------PNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRM
TRMH_SHIFL      -----------------------------VCMEQVHKPHNVSAIIRTADAV---GVHEVHAVWPSRMRTM
TRMH_ECOLI      -----------------------------VCMEQVHKPHNVSAIIRTADAV---GVHEVHAVWPSRMRTM
TRMH_ECO57      -----------------------------VCMEQVHKPHNVSAIIRTADAV---GVHEVHAVWPSRMRTM
Y346_MYCGE      -------------------------------------PNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRM
YGL3_BACST      -------------------------------------PANTGNIARTCAATNTALHLIRPLGFSTDDKML
MRM1_MOUSE      ----------------------------WLVLEGLQDPRNLGAVMRSAHFLGVDRVITSQRNSCPLTPVV
Y1673_SYNY3     -------------------------------LERLQDPGNLGTILRTAAATGVEGIWLTADCVDPTSPKV
TSNR_STRLU      -----------------------------VLLDGVKIVGNIGAIVRTRSALGAAGIVLVDSGLGTIARRL
Y424_HAEIN      -HGGICLLVKKPRAFTLQGYLDPRNEDCLVLLDNVNNAQNIGGVLRTCAYFGVKNIVADNVENLYSAASM
TARB1_HUMAN     ----------------------GKSISRLIVVASLIDPTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQ
Y052_BORBU      ------------------------NYLTFV-LEDIFQSQNASATIRTGEILGLSDVHVIEKK--NKHTLN
TSNR_STRCN      -----------------------------VVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIARRL


                         +         .         .         .         .         *         .:210
query           YKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGK
TRMHL_STAAE     AKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNATDYRNLEADMSLAIVIGSEGQGMSRLVSD
TRMHL_STAAC     AKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNATDYRNLEADMSLAIVIGSEGQGMSRLVSD
YACO_BACSU      AKASTGAIEHIPVARVTNLARTLEEMKERGIWVVGTDASAREDFRNMDGNMPLALVIGSEGKGMGRLVKE
TRMHL_STAAW     AKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNATDYRNLEADMSLAIVIGSEGQGMSRLVSD
TRMHL_STAAS     AKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNATDYRNLEADMSLAIVIGSEGQGMSRLVSD
TRMHL_STAAR     AKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNATDYRNLEADMSLAIVIGSEGQGMSRLVSD
TRMHL_STAAN     AKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNATDYRNLEADMSLAIVIGSEGQGMSRLVSD
TRMHL_STAAM     AKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNATDYRNLEADMSLAIVIGSEGQGMSRLVSD
TRMHL_STAHJ     AKASTGAIQHVPVMRVTNLAKTIDELKEHGYWVAGAEADNATDYRDMAADMPLAIVIGSEGQGMSRLVKD
TRMHL_STAS1     AKASTGAIQHIPVMRVTNLANTIETLKDNGYWIVGTEAENSTDYREMDAGMPLGIVIGSEGQGMSRLVKE
TRMHL_STAES     AKASTGAIQHVPVIRVTNLSKTIDELKDNGFWIAGTEANNATDYRDLQADMSLGIVIGSEGQGMSRLVSD
TRMHL_STAEQ     AKASTGAIQHVPVIRVTNLSKTIDELKDNGFWIAGTEANNATDYRDLQADMSLGIVIGSEGQGMSRLVSD
Y955_SYNY3      MKVAAGALEHFPVARVVNLSRALETLKESGFWIYGTVAGKQTALHQADLREPMGLVIGSEGEGLSLLTQK
RLMB_PSEAE      RKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEADKTLYQLDLKGPTVLVMGAEGKGMRRLTRE
RLMB_COXBU      RKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETLIQEIDLTGDIAIVLGSEGAGLRRLTKE
RLMB_HAEIN      RKVACGAAETVPLIRVTNLSRTLRDLQQNNIWVVGTAGEATETIYQSKLTGPLALVMGAEGEGMRRLTRE
RLMB_SHIFL      KKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMTGRLALVMGAEGEGMRRLTRE
RLMB_ECOLI      KKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMTGRLALVMGAEGEGMRRLTRE
RLMB_ECOL6      KKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMTGRLALVMGAEGEGMRRLTRE
RLMB_ECO57      KKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMTGRLALVMGAEGEGMRRLTRE
RLMB_SHEON      SKVACGAAETVPLFQVTNLARTMRHLQEKGVWIVGTAGEADCELYQADLKGPLAIAMGAEGKGLRRLSRE
RLMB_NEIMB      SKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMSGESDLYHCNLPDSAAWVMGNEGDGMRRLTRE
RLMB_XYLFA      RKTSSGAADRLPVIAVVNLARSLRELQKQDVWIYGLEGEAETSLYALDLRGKVALVLGGEADGLRRLTRE
RLMB_HAEDU      RKVACGAAEAMPLIRVTNLARTMRELQDKHIWIVGTAGEATTDIYTSQLTGAIALVMGAEGDGMRRLTRE
RLMB_SALTY      KKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMPGRMALVMGAEGEGMRRLTRE
RLMB_NEIMA      SKVASGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGNADLYHCDLPDSAAWVMGNEGDGMRRLTRE
RLMB_SALTI      KKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMPGRMALVMGAEGEGMRRLTRE
RLMB_YERPE      KKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTAGEADHTLYQSKMTGPMALVMGAEGEGMRRLTRE
RLMB_PASMU      RKVACGAAEVVPLIRVTNLARTLRELQQKNIWVVGTAGEATNTLYQTQLTGGLALVMGAEGEGMRRLTRE
RLMB_ERWCT      KKVACGAAETIPVISVTNLARTMRLLQERNIWIVGTAGEADHTLYQSKLTGPLALVMGAEGEGMRRLTRE
RLMB_PHOLL      KKVACGAAESVPLIRVTNLARTLRLLQEYNIWVVGTAGEADHTLYQSKLTGPMALVMGAEGEGMRRLTRE
RLMB_XYLFT      RKTSSGAADRLPVIAVVNLARSLRELQKQDVWIYGLAGEVETSLYALDLRGNVALVLGGEADGLRRLTRE
RLMB_VIBPA      -KVACGAAEVVPLIRVTNLARTMRTLQEQGIWFVGTAGEATHDIYQAKLTGPLAIVMGAEGDGMRRLTRE
RLMB_PHOPR      SKVACGAAEVMPLVRVTNLARTMRALQDKGVWIVGTAGEATHDIYHSKLTGPLAIVMGAEGEGMRRLTRE
RLMB_VIBCH      SKVACGAAETVPLVRVTNLARTMRALQEKGVWFVGTAGEATHDIYQSKLTGSLAIVMGAEGDGMRRLTRE
RLMB_VIBVY      SKVACGAAETVPLVRVTNLARTMRHLQEQGIWIVGTAGEATHDIYQAKLTGSLAIVMGAEGDGMRRLTRE
RLMB_VIBVU      SKVACGAAETVPLVRVTNLARTMRHLQEQGIWIVGTAGEATHDIYQAKLTGSLAIVMGAEGDGMRRLTRE
RLMB_PSEPK      RKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEQEIYQQDLTGPLVMIMGAEGKGMRRLTRE
RLMB_CHRVO      SKVACGAAEVVPYITVTNLARTLRDLKDAGVWIAGTTMEADTDLYHFDASGPLAWVMGAEGEGMRRLTRE
RLMB_PSESM      RKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVELYQQDLTGPTIIIMGAEGKGMRRLTRE
RLMB_XANAC      RKTSAGAADRIPVVAVTNLARCLRDLQKQGVWLYGLAGEAEASLYSVDLRGNVGLVLGGEADGLRRLTRE
RLMB_BLOFL      RKVASGSSDRVPFVRVTNLSRTLKLLKKYNIYIVGSVLRSNQILFNTRLIDPIALVMGSESSGIRRLTRE
Y479_MYCPA      WRTSXXXXXXXXXXXXTNLTRTLQDWADRGLRVIGLDAGGDTMLDDLDGSDPLVVVVGSEGKGLSRLVRQ
Y572_MYCA9      WRTSXXXXXXXXXXXXTNLTRTLKDWQDKGITIVGLDAGGDTELDNLDGVGDIAVVVGSEGKGLSQLVRK
RLMB_BORPE      QRVACGAADTVPYLTVTNLARTMRELKERDVWLVGTDDQAGESMHQVDARRSMAWVMGAEGEGMRRLTRE
RLMB_BORPA      QRVACGAADTVPYLTVTNLARTMRELKERDVWLVGTDDQAGESMHQVDARRSMAWVMGAEGEGMRRLTRE
RLMB_BORBR      QRVACGAADTVPYLTVTNLARTMRELKERDVWLVGTDDQAGESMHQVDARRSMAWVMGAEGEGMRRLTRE
RLMB_NITEU      HKVASGAVDTVPFFAVTNLARTLRELKEMGLWIVGTAADAPDTLDSVTLTRPLAWVLGAEDGGMRRLTRE
RLMB_RALSO      AKVASGAAETVPYITVTNLARTLRELQQRGVWVIGTADEAEQDLYRADFKGPIALVMGAEGEGMRRLTRE
Y6073_MYCS2     WRTSXXXXXXXXXXXXTNLNRTLKSFADAGLQIVGLDAGGDTTLDELDATGPTVVVVGSEGKGLSRLVRE
Y252_MYCGE      -KTSMGSVFYQNLVQVANLSYTITKLKEIGFWVSTLDPIWKPDYRKVDF-AKKILIVGNEDRGVNQLITK
Y2399_ARCFU     VKASAGAVFHIPIARVENFASAIKKLKKLGFTTLAADLDGE-DLEAVSLLLPAAVVIGGEDRGVSRPVKK
Y1447_MYCGI     WRTSXXXXXXXXXXXXXNLNRTLKQYADAGLQVVGLDAGGDTTIDEIDGLTPTIVVVGSEGKGLSRLVRE
Y5337_MYCVP     WRTSXXXXXXXXXXXXXNLTRALKQWADAGLQVVGLDADGDTTVDQIDGAGPIVVVVGSEGKGLSRLVRE
MRM1_DICDI      SKSSSGACESFVINRTESIEGFLKSSQRNGWNVVGLDDLNENDINQIKLDQPTILILGNEGFGLKPSVLE
YSGA_BACSU      LRSAQGSHFHIPVVR-RNLPSYVDELKAEGVKVYGTALQNGAPYQEIPQSESFALIVGNEGAGVDAALLE
Y516_BORBU      LRTSSGASQYXXXXXXXXXXXXXXXXXXYGFWIYTXXXXXXXXXXXXXXXXXXALILGNEGKGVHKLIKE
Y355_MYCPN      IRTSMGTVFYQNLVQVTNLSYAITTLQKHGFWTVALDERKPKDYRQVDFD-KRILLVGNEXXXXXXXXXX
Y574_MYCA1      WRTSXXXXXXXXXXXXTNLTRTLQDWADRGLRVIXXXXXXXXXXXXXXXXXXXVVVVGSEGKGLSRLVRQ
RLMB_XANCP      RKTSAGAADRIPVVAVTNLARCLRDLQKQGVWLYGLAGEAEASLYSXXXXXXXXXXXXXXXXXXXXXTRE
Y5079_MYCMM     WRTSXXXXXXXXXXXXTNLTRALKDWADRGVRVVGLDAGGDTAIDDLDGSDPIVVVVGSEGKGLSRLVRQ
Y4155_MYCUA     WRTSXXXXXXXXXXXXTNLTRALKDWADRGVRVVGLDAGGDTAIDDLDGSDPIVVVVGSEGKGLSRLVRQ
MRM1_SCHPO      SKASAGALEVFNISHVKNPMVFLRNSVLKGWKVIGTDNKDQKIKTELMNEPK-ILVLGSEK-GLRTNILT
MRM1_HUMAN      SKSSAGAMEVMDVFSTDDLTGFLQTKAQQGWLVAGTDPQSSESCLEFLWERPTLLVLGNEGSGLSQEVQA
Y5122_MYCSJ     WRTSXXXXXXXXXXXXTNLNRTLKSWADGGLQVVXXXXXXXXXXXXXXXXXPVVVVVGSEGKGLSRLVRE
Y4822_MYCSK     WRTSXXXXXXXXXXXXTNLNRTLKSWADGGLQVVXXXXXXXXXXXXXXXXXPVVVVVGSEGKGLSRLVRE
Y4736_MYCSS     WRTSXXXXXXXXXXXXTNLNRTLKSWADGGLQVVXXXXXXXXXXXXXXXXXPVVVVVGSEGKGLSRLVRE
MRM1_YEAST      SKTSSGALELLPIFYVDKPLEFFTKSQEMGGWTFLANATSEKDLNGLCNELPVVLVVGNESQGVRTNLKM
RLMB_ACIAD      RKVAAGGAEKVKFIQVTNLARTLAHIKAHFFVKVVGTMLDEKALPIQKYDGNVAIVMGAEDTGLRPITQS
Y324_MYCLE      WRTSXXXXXXXXXXXXTNLTRALKVWADQGLRVIXXXXXXXXXXXXXXXXXPLAVVVGSEGKGLSRLVRH
Y324_MYCLB      WRTSXXXXXXXXXXXXTNLTRALKVWADQGLRVIXXXXXXXXXXXXXXXXXPLAVVVGSEGKGLSRLVRH
YFIF_ECOLI      IRTAEGGAEHVQPITGDNIVNVLDDFRQAGYTVVTTSSEQGKPLFKTSLPAKMVLVLGQEYEGLPDAARD
YFIF_ECO57      IRTAEGGAEHVQPITGDNIVNVLDDFRQAGYTVVTTSSEQGKPLFKTSLPAKMVLVLGQEYEGLPDAARD
Y3618_MYCTA     WRTSXXXXXXXXXXXXTNLTRTLKGWADRGVRVIXXXXXXXXXXXXXXXXXSLVVVVGSEGKGLSRLVRQ
Y3579_MYCTU     WRTSXXXXXXXXXXXXTNLTRTLKGWADRGVRVIXXXXXXXXXXXXXXXXXSLVVVVGSEGKGLSRLVRQ
Y3644_MYCBP     WRTSXXXXXXXXXXXXTNLTRTLKGWADRGVRVIXXXXXXXXXXXXXXXXXSLVVVVGSEGKGLSRLVRQ
Y3610_MYCBO     WRTSXXXXXXXXXXXXTNLTRTLKGWADRGVRVIXXXXXXXXXXXXXXXXXSLVVVVGSEGKGLSRLVRQ
Y905_MYCBO      VRVSMGHALLVPYARAADWPTELMTLKESGFRLLAMTPHGNEAIAAVSHE-RIALLVGAEGPGLTAAALR
Y881_MYCTU      VRVSMGHALLVPYARAADWPTELMTLKESGFRLLAMTPHGNEAIAAVSHE-RIALLVGAEGPGLTAAALR
RLMB_BURSP      XXXXXXXXETVPYLTVINXXXXXXXXKNAGIQVIGTADDATTSLFDIQLDGALALVMGAEGAGMRRLTRE
Y521_MYCPN      VRAGLNCWDKVQMFEHKSIETTPPN---KAIWLLTKSGTTTPDQINMQTDNREQLVFGQETKGLPQTMEQ
TRMH_SHIFL      ASAAAGSNSWVQVKTHRTIGDAVAHLKGQGMQILATHLSDNADFREIDYTRPTCILMGQEKTGITQEALA
TRMH_ECOLI      ASAAAGSNSWVQVKTHRTIGDAVAHLKGQGMQILATHLSDNADFREIDYTRPTCILMGQEKTGITQEALA
TRMH_ECO57      ASAAAGSNSWVQVKTHRTIGDAVAHLKGQGMQILATHLSDNADFREIDYTRPTCILMGQEKTGITQEALA
Y346_MYCGE      VRAGLNCWDKIQLFEHKSWEHFLQATTEKTIWL--LTKSGDKTPDQIKLPNELYFVFGQETKGLKTIMDN
YGL3_BACST      RRAGLDYWEFVNIHYYDSLDHFFQQNQNGDF--YYITKFGKRYYTSYDFSDPSFFIFGRETTGLKELLAE
MRM1_MOUSE      SKASAGAMEVMDVFATPDLPGFLQAKAQQGWLVVG-----------------------------------
Y1673_SYNY3     LRSSAGXXXXXXXXXXXXXXXXXEKFHTQGLQLIATVPQATQTLWEIDFQRPTIVIFGSEGQGLSAPVLE
TSNR_STRLU      IRASRGYVFSLPIV-LATRDEALAFFRDGGMRPVVFEADGKLSIGELDGDERLVLVFGSEKTGPSGEFAG
Y424_HAEIN      -RVAEGGAEYIRVLEADYIDSALMQLRKSGYQI-------------------------------------
TARB1_HUMAN     HLSVSA-EQWLPLVEVKQLIDYLQQKKTEGYTIIGVEQTAKSDLTQYCFPEKSLLLLGNEREGIPANLIQ
Y052_BORBU      PDVTLGSSQWINLNKYKNAKFAIDRLKSDGYSIVATSLNPKSNLENLTINNKMAIFFGTELTGLSAEVLG
TSNR_STRCN      QRASRGYVFSLPVV-LSGREEAIAFIRDSGMQLMTLKADGDISVKEL---GDNALLFGSEKGGPSDLFEE


                         .         .         .         +         .         .         .:280
query           YTDFFVKIDINKDVESLNISNSAAIVFHHLSYLKKNS
TRMHL_STAAE     KCDFYIKIPMVGHVNSLNASVAASLMMYEV-------
TRMHL_STAAC     KCDFYIKIPMVGHVNSLNASVAASLMMYEV-------
YACO_BACSU      KCDFLIKLPMAGKVTSLNASVAAGLLMYEV-YRKRN-
TRMHL_STAAW     KCDFYIKIPMVGHVNSLNASVAASLMMYEV-------
TRMHL_STAAS     KCDFYIKIPMVGHVNSLNASVAASLMMYEV-------
TRMHL_STAAR     KCDFYIKIPMVGHVNSLNASVAASLMMYEV-------
TRMHL_STAAN     KCDFYIKIPMVGHVNSLNASVAASLMMYEV-------
TRMHL_STAAM     KCDFYIKIPMVGHVNSLNASVAASLMMYEV-------
TRMHL_STAHJ     KCDFYIKIPMVGHVNSLNASVAASLMMYEV-YRKRH-
TRMHL_STAS1     KCDFYINIPMVGHVNSLNASVAASLMMYEV-FRKRN-
TRMHL_STAES     KCDFHIKIPMVGHVNSLNASVAASLMMYEV-YRKRH-
TRMHL_STAEQ     KCDFHIKIPMVGHVNSLNASVAASLMMYEV-YRKRH-
Y955_SYNY3      HCDHLITIPLAGKTPSLNASVAAAISLYEI-------
RLMB_PSEAE      HCDFLARLPMAGSVSSLNVSVATGV------------
RLMB_COXBU      RCDFLAQIPLRGSVESLNVSVACGICLYEV-------
RLMB_HAEIN      HCDQLISIPMAGSVSSLNVSVATGV------------
RLMB_SHIFL      HCDELISIPMAGSVSSLNVSVATGI------------
RLMB_ECOLI      HCDELISIPMAGSVSSLNVSVATGI------------
RLMB_ECOL6      HCDELISIPMAGSVSSLNVSVATGI------------
RLMB_ECO57      HCDELISIPMAGSVSSLNVSVATGI------------
RLMB_SHEON      CCDTLVSIPMSGSVSSLNVSVATGI------------
RLMB_NEIMB      HCDMLVSIPMFGTVESMNVSVSAGMV-----------
RLMB_XYLFA      HCDVLARIPMPGEVESLNVSVAAGV------------
RLMB_HAEDU      HCDQLVSIPMAGSVSSLNVSVATGV------------
RLMB_SALTY      HCDELISIPMAGSVSSLNVSVATGI------------
RLMB_NEIMA      HCDMLVSIPMFGTVESMNVSVSAGMV-----------
RLMB_SALTI      HCDELISIPMAGSVSSLNVSVATGI------------
RLMB_YERPE      HCDELISIPMAGSVSSLNVSVATGV------------
RLMB_PASMU      HCDQLISIPMAGSVSSLNVSVATGV------------
RLMB_ERWCT      HCDELISIPMAGSVSSLNVSVATGV------------
RLMB_PHOLL      HCDELISIPMVGSVSSLNVSVATGV------------
RLMB_XYLFT      HCDVLARIPMPGEVESLNVSVAAGV------------
RLMB_VIBPA      TCDDLIKIPMAGSVSSLNVSVASGI------------
RLMB_PHOPR      TCDDLIKIPMAGSVSSLNVSVATGI------------
RLMB_VIBCH      TCDDLIKIPMAGSVSSLNVSVACGV------------
RLMB_VIBVY      TCDDLIKIPMAGAVSSLNVSVASGI------------
RLMB_VIBVU      TCDDLIKIPMAGAVSSLNVSVASGI------------
RLMB_PSEPK      HCDFLVKLPMAGSVSSLNVSVATGV------------
RLMB_CHRVO      HCDVLVSIPMFGTVESLNVSVSSGMV-----------
RLMB_PSESM      HCDYLVRLPMAGSVSSLNVSVATGV------------
RLMB_XANAC      HCDGLVKIPMPGEIESLNVSVATGV------------
RLMB_BLOFL      NCDKLVHIPTLQSTVSLNVSVATGI------------
Y479_MYCPA      NCDEVVSIPMAGSAESLNASVAAGVVLAEIS------
Y572_MYCA9      TCDAVVSIPMAGPVESLNASVAAGVVLAEIA------
RLMB_BORPE      TCDQLVRIPMLGSVESLNVSVASAVCLY---------
RLMB_BORPA      TCDQLVRIPMLGSVESLNVSVASAVCLY---------
RLMB_BORBR      TCDQLVRIPMLGSVESLNVSVASAVCLY---------
RLMB_NITEU      ACDLLVSIPMSGSIESLNVSVSAGI------------
RLMB_RALSO      TCDTLVSIPMAGSVESLNVSVASGV------------
Y6073_MYCS2     HCDAIVSIPMAGPTESLNASVAAGVVLAEIARQRRS-
Y252_MYCGE      NADCRIKIPMNNKINSLNVSVALGII-----------
Y2399_ARCFU     QCDFVVKIPGVGKVNSLNLSVAAGIFLYTLSRQK---
Y1447_MYCGI     NCDRIVSIPMAGPTESLNASVAAGVVLAEIARQRRLS
Y5337_MYCVP     NCDAVVSIPMAGPTESLNASVAAGVVLAEIARQRRSA
MRM1_DICDI      ICNKTIKIGGNYKIDSLNVSVTSGILIHTL-------
YSGA_BACSU      KTDLNLYVPLYGQAESLNVAVAAAILVYHL-------
Y516_BORBU      NSDFLIRIPTSGKIDSLNVSVSTGILIFEI-------
Y355_MYCPN      XXXXKVKIPMNPKLNSLNVSVAVGII-----------
Y574_MYCA1      NCDEVVSIPMAGSAESLNASVAAGVVLAEIS------
RLMB_XANCP      HCDGLVKIPMPGDIESLNVSVATGV------------
Y5079_MYCMM     TCDEVVSVPMAGPTESLNASVAAGVVLAEIA------
Y4155_MYCUA     TCDEVVSVPMAGPTESLNASVAAGVVLAEIA------
MRM1_SCHPO      QCSHYVSIGGDKYVDSLNVSVAAGILLYSL-------
MRM1_HUMAN      SCQLLLTIQLPPGLESLNVSVAAGILLHSICSQRK--
Y5122_MYCSJ     NCDAVVSIPMAGPTESLNASVAAGVVLAEIARQRRS-
Y4822_MYCSK     NCDAVVSIPMAGPTESLNASVAAGVVLAEIARQRRS-
Y4736_MYCSS     NCDAVVSIPMAGPTESLNASVAAGVVLAEIARQRRS-
MRM1_YEAST      RSDFFVEIGIEKGVDSLNVSVATALLIDNI-------
RLMB_ACIAD      QCDQTVYIPMSGNLQSLNVSVAAGMALY---------
Y324_MYCLE      SCDEVVSIPMAGQVESLNASVAVGVVLAEIA------
Y324_MYCLB      SCDEVVSIPMAGQVESLNASVAVGVVLAEIA------
YFIF_ECOLI      PNDLRVKIDGTGNVAGLNISVATGVL-----------
YFIF_ECO57      PNDLRVKIDGTGNVAGLNISVATGVL-----------
Y3618_MYCTA     NCDEVVSIPMAAQAESLNASVAAGVVLAEIA------
Y3579_MYCTU     NCDEVVSIPMAAQAESLNASVAAGVVLAEIA------
Y3644_MYCBP     NCDEVVSIPMAAQAESLNASVAAGVV-----------
Y3610_MYCBO     NCDEVVSIPMAAQAESLNASVAAGVV-----------
Y905_MYCBO      ISDVRVRIPMSRGTDSLNVATAAALAFY---------
Y881_MYCTU      ISDVRVRIPMSRGTDSLNVATAAALAFY---------
RLMB_BURSP      ACDEVVRIPLAGHVQSLNVSVASGI------------
Y521_MYCPN      YSQNQVRIPIWNPVRSINLSNTVACVLY--EYAKQN-
TRMH_SHIFL      LADQDIIIPMIGMVQSLNVSVASALILYEAQRQRQNA
TRMH_ECOLI      LADQDIIIPMIGMVQSLNVSVASALILYEAQRQRQNA
TRMH_ECO57      LADQDIIIPMIGMVQSLNVSVASALILYEAQRQRQNA
Y346_MYCGE      FKQNQIRIPIWNSVRSINLANAVVCILY--EYSKQN-
YGL3_BACST      NEDRCLRIPMTENVRALNLSNTAAILVY---------
MRM1_MOUSE      -------------------------------------
Y1673_SYNY3     LTTHQVAIPQAPQVESLNVAIAVGVMLY---------
TSNR_STRLU      VATESVSIPMNPAAESLNVSVSAGIALH---------
Y424_HAEIN      -------------------------------------
TARB1_HUMAN     QLDVCVEIPQQGIIRSLNVHVSGALL-----------
Y052_BORBU      AADLYVKIPMYGFTQSYNISVAVAIVMYSLMRLRKSS
TSNR_STRCN      ASSASVSIPMMSQTESLNVSVSLGIALH---------