[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21946.1

[Show Plain Result]


## Summary of Sequence Search
    1::110
    2::105     7e-31  57%  111 aa  GLRX2_RICTY RecName: Full=Probable monothiol glutaredoxin-2;
    5::104     1e-28  59%  107 aa  GLRX2_RICPR RecName: Full=Probable monothiol glutaredoxin-2;
    1::102     3e-27  51%  107 aa  YC64L_SYNY3 RecName: Full=Uncharacterized monothiol glutaredoxin
    2::103     3e-27  50%  107 aa  GLRX2_RICCN RecName: Full=Probable monothiol glutaredoxin-2;
   72::168     1e-26  49%  173 aa  GRS14_ARATH RecName: Full=Monothiol glutaredoxin-S14,
   74::163     2e-26  52%  168 aa  GRXS7_ORYSJ RecName: Full=Monothiol glutaredoxin-S7,
   28::125     2e-26  56%  143 aa  GLRX5_SACKL RecName: Full=Monothiol glutaredoxin-5,
   63::163     4e-26  45%  169 aa  GRS15_ARATH RecName: Full=Monothiol glutaredoxin-S15;       
  142::242     5e-26  50%  244 aa  GLRX5_SCHPO RecName: Full=Monothiol glutaredoxin-5;
  387::488     8e-26  45%  488 aa  GRS17_ARATH RecName: Full=Monothiol glutaredoxin-S17;       
  147::251     8e-26  46%  491 aa  GRS11_ORYSJ RecName: Full=Monothiol glutaredoxin-S11;
   21::126     1e-25  49%  146 aa  GLRX4_SCHPO RecName: Full=Monothiol glutaredoxin-4;
   19::103     2e-25  58%  104 aa  GLRX2_RICFE RecName: Full=Probable monothiol glutaredoxin-2;
   60::144     1e-24  56%  157 aa  GLRX5_HUMAN RecName: Full=Glutaredoxin-related protein 5;
    1::102     2e-24  46%  107 aa  YCF64_PORPU RecName: Full=Uncharacterized monothiol glutaredoxin
   56::139     2e-24  57%  152 aa  GLRX5_MOUSE RecName: Full=Glutaredoxin-related protein 5;
    1::102     4e-24  44%  107 aa  YCF64_PORYE RecName: Full=Uncharacterized monothiol glutaredoxin
   41::138     4e-24  42%  143 aa  GLRX5_DICDI RecName: Full=Monothiol glutaredoxin-5;
  194::292     6e-24  48%  293 aa  GRS16_ARATH RecName: Full=Monothiol glutaredoxin-S16,
    7::107     8e-24  42%  107 aa  GLRX4_BUCAP RecName: Full=Glutaredoxin-4;       
   35::127     3e-23  52%  150 aa  GLRX5_YEAST RecName: Full=Monothiol glutaredoxin-5,
   75::174     4e-23  44%  185 aa  GRXS4_ORYSJ RecName: Full=Monothiol glutaredoxin-S4;Flags:
  139::217     1e-22  51%  326 aa  GLRX3_DANRE RecName: Full=Glutaredoxin 3;
   75::174     3e-22  42%  185 aa  GRXS1_ORYSJ RecName: Full=Montothiol glutaredoxin-S1,
  248::331     3e-22  50%  335 aa  GLRX3_HUMAN RecName: Full=Glutaredoxin-3;AltName:
  247::331     3e-22  48%  334 aa  GLRX3_BOVIN RecName: Full=Glutaredoxin-3;AltName:
    2::85      6e-22  45%   89 aa  GLRXA_LEGPH RecName: Full=Probable monothiol glutaredoxin grlA;
  139::219     7e-22  49%  326 aa  GLRX3_XENTR RecName: Full=Glutaredoxin-3;AltName:
  250::334     1e-21  47%  337 aa  GLRX3_RAT RecName: Full=Glutaredoxin-3;AltName:
  250::334     1e-21  47%  337 aa  GLRX3_MOUSE RecName: Full=Glutaredoxin-3;AltName:
    3::108     2e-21  37%  115 aa  GLRX4_SHIFL RecName: Full=Glutaredoxin-4;       
    3::108     2e-21  37%  115 aa  GLRX4_ECOLI RecName: Full=Glutaredoxin-4;       
    3::108     2e-21  37%  115 aa  GLRX4_ECOL6 RecName: Full=Glutaredoxin-4;       
    3::108     2e-21  37%  115 aa  GLRX4_ECO57 RecName: Full=Glutaredoxin-4;       
  151::235     2e-21  47%  240 aa  GLRX3_DICDI RecName: Full=Glutaredoxin-3 homolog;
  185::279     8e-21  48%  285 aa  GRS12_ORYSJ RecName: Full=Monothiol glutaredoxin-S12,
    3::101     1e-20  37%  107 aa  GLRX4_HAEI8 RecName: Full=Glutaredoxin-4;       
    3::101     4e-20  36%  107 aa  GLRX4_HAEIN RecName: Full=Glutaredoxin-4;       
    3::101     5e-20  37%  109 aa  GLRX4_PASMU RecName: Full=Glutaredoxin-4;       
    3::101     5e-20  36%  107 aa  GLRX4_HAEDU RecName: Full=Glutaredoxin-4;       
  153::233     7e-20  44%  244 aa  GLRX4_YEAST RecName: Full=Monothiol glutaredoxin-4;
  198::273     1e-19  49%  285 aa  GLRX3_YEAST RecName: Full=Monothiol glutaredoxin-3;
   19::94      4e-19  45%  108 aa  GLRX4_BUCAI RecName: Full=Glutaredoxin-4;       
   20::100     1e-18  40%  108 aa  GLRX4_BUCBP RecName: Full=Glutaredoxin-4;       
  117::205     2e-08  39%  697 aa  TRXR3_MOUSE RecName: Full=Thioredoxin reductase 3;       
   39::116     3e-08  32%  125 aa  GRXC1_ARATH RecName: Full=Glutaredoxin-C1;         Short=AtGrxC1;
   72::129     5e-08  40%  146 aa  YZ73_CAEEL RecName: Full=Uncharacterized monothiol glutaredoxin
   49::126     5e-08  31%  133 aa  GRXC4_ORYSJ RecName: Full=Glutaredoxin-C4, chloroplastic;AltName:
   23::100     5e-08  27%  111 aa  GRXC2_ARATH RecName: Full=Glutaredoxin-C2;         Short=AtGrxC2;
   10::100     1e-07  33%  104 aa  GLRX_VERFO RecName: Full=Glutaredoxin;
  172::262     5e-07  34%  754 aa  TRXR3_HUMAN RecName: Full=Thioredoxin reductase 3;       
   10::100     5e-07  27%  102 aa  GLRX_RICCO RecName: Full=Glutaredoxin;
   10::100     7e-07  26%  108 aa  GLRX_SOLLC RecName: Full=Glutaredoxin;
   29::124     2e-06  27%  131 aa  GRXS6_ORYSJ RecName: Full=Monothiol glutaredoxin-S6;Flags:
   52::140     2e-06  29%  157 aa  GLRX2_BOVIN RecName: Full=Glutaredoxin-2, mitochondrial;Flags:
   37::127     3e-06  30%  130 aa  GRXC3_ARATH RecName: Full=Glutaredoxin-C3;       
   95::171     3e-06  27%  179 aa  GRS12_ARATH RecName: Full=Monothiol glutaredoxin-S12,
   66::154     3e-06  30%  166 aa  GLRX3_SCHPO RecName: Full=Monothiol glutaredoxin-3;
   59::160     3e-06  29%  164 aa  GRS10_ORYSJ RecName: Full=Monothiol glutaredoxin-S10;Flags:
   36::128     4e-06  31%  136 aa  GRXC8_ORYSJ RecName: Full=Glutaredoxin-C8;AltName:
   23::98      4e-06  27%  112 aa  GRXC6_ORYSJ RecName: Full=Glutaredoxin-C6;AltName:
   17::92      4e-06  37%   98 aa  GLRX1_RICBR RecName: Full=Glutaredoxin-1;
   48::98      6e-06  31%  100 aa  GLRX_DICDI RecName: Full=Glutaredoxin;
   51::152     6e-06  25%  157 aa  GLRX2_RAT RecName: Full=Glutaredoxin-2, mitochondrial;Flags:
   55::143     6e-06  27%  161 aa  GLRX2_PONAB RecName: Full=Glutaredoxin-2, mitochondrial;Flags:
   51::139     6e-06  27%  156 aa  GLRX2_MOUSE RecName: Full=Glutaredoxin-2, mitochondrial;Flags:
   33::129     7e-06  27%  135 aa  GRXC4_ARATH RecName: Full=Glutaredoxin-C4;       
    6::103     7e-06  24%  106 aa  GLRX1_PIG RecName: Full=Glutaredoxin-1;AltName:
   77::122     1e-05  50%  123 aa  GLRXL_DICDI RecName: Full=Glutaredoxin-like protein;
   17::95      1e-05  31%   95 aa  GLRX1_RICPR RecName: Full=Glutaredoxin-1;
    6::103     1e-05  25%  106 aa  GLRX1_BOVIN RecName: Full=Glutaredoxin-1;AltName:
   58::146     2e-05  27%  164 aa  GLRX2_HUMAN RecName: Full=Glutaredoxin-2, mitochondrial;Flags:
   10::103     2e-05  24%  107 aa  GLRX1_RAT RecName: Full=Glutaredoxin-1;AltName:
  288::320     3e-05  39%  390 aa  Y5986_ARATH RecName: Full=Uncharacterized protein At5g39865;
   17::95      3e-05  32%  104 aa  GLRX1_RICTY RecName: Full=Glutaredoxin-1;
    2::102     3e-05  22%  106 aa  GLRX1_RABIT RecName: Full=Glutaredoxin-1;AltName:
  455::521     4e-05  28%  582 aa  GRCR2_DROME RecName: Full=Glutaredoxin domain-containing
  183::227     4e-05  36%  290 aa  GRCR1_HUMAN RecName: Full=Glutaredoxin domain-containing
   53::139     4e-05  30%  143 aa  GLRX2_YEAST RecName: Full=Glutaredoxin-2, mitochondrial;AltName:
  183::227     6e-05  36%  290 aa  GRCR1_MOUSE RecName: Full=Glutaredoxin domain-containing
    1::101     6e-05  26%  110 aa  GLRX2_SCHPO RecName: Full=Glutaredoxin-2;
   10::103     6e-05  23%  107 aa  GLRX1_MOUSE RecName: Full=Glutaredoxin-1;AltName:
  327::394     8e-05  29%  454 aa  GRCR1_DROME RecName: Full=Glutaredoxin domain-containing
   10::103     8e-05  23%  106 aa  GLRX1_HUMAN RecName: Full=Glutaredoxin-1;AltName:
    4::98      1e-04  27%  102 aa  GRXS3_ARATH RecName: Full=Monothiol glutaredoxin-S3;       
   59::92      1e-04  41%  102 aa  GLRX1_RICCN RecName: Full=Glutaredoxin-1;
   55::153     1e-04  28%  649 aa  TRXR1_HUMAN RecName: Full=Thioredoxin reductase 1, cytoplasmic;    
   59::90      2e-04  44%  102 aa  GLRX1_RICFE RecName: Full=Glutaredoxin-1;
    4::98      4e-04  26%  102 aa  GRXS4_ARATH RecName: Full=Monothiol glutaredoxin-S4;       
    4::98      5e-04  26%  102 aa  GRXS5_ARATH RecName: Full=Monothiol glutaredoxin-S5;       
   21::98      7e-04  27%  102 aa  GRXS7_ARATH RecName: Full=Monothiol glutaredoxin-S7;       
   21::98      7e-04  27%  102 aa  GRXS2_ARATH RecName: Full=Monothiol glutaredoxin-S2;       
   12::83      0.001  24%   83 aa  GLRX3_ECOLI RecName: Full=Glutaredoxin-3;         Short=Grx3;
   12::83      0.001  24%   83 aa  GLRX3_ECOL6 RecName: Full=Glutaredoxin-3;         Short=Grx3;
   12::83      0.001  24%   83 aa  GLRX3_ECO57 RecName: Full=Glutaredoxin-3;         Short=Grx3;
    1::110

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDDSTKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREGIKEFSDWP
GLRX2_RICTY     MENKNLKFIQNAIKKNKVVLFMKGTKEMPACGFSGTVVAILNKLGVEFSDINVLFDTSLREDLKKFSDWP
GLRX2_RICPR     -----KNLIQNAIKKNKVVLFMKGTKEMPACGFSGTVVAILNKLGVEFSDINVLFDTALREDLKKFSDWP
YC64L_SYNY3     MNPETKARIDQLVTANKVMVFMKGTKLMPQCGFSNNVVQILNMLGIPFETLDVLADAEIRQGIKEYSNWP
GLRX2_RICCN     LENKNFKFIENEIKNNKVVLFMKGIKKSPACGFSGTVVAILNKLGVEFRDINVLFDAELREDLKKFSDWP
GRS14_ARATH     -----KDTLEKLVNSEKVVLFMKGTRDFPMCGFSNTVVQILKNLNVPFEDVNILENEMLRQGLKEYSNWP
GRXS7_ORYSJ     ------------VGSHKVVLFMKGTKDFPQCGFSHTVVQILRSLDVPFETLDVLANEALRQGLKEYSSWP
GLRX5_SACKL     LSTETKQAIESAIESAPVVLFMKGTPEFPQCGFSKATINMLGVDPMKFAAYNVLEDAELREGVKEFSEWP
GRS15_ARATH     --DSLKDIVENDVKDNPVMIYMKGVPESPQCGFSSLAVRVLQQYNVPISSRNILEDQELKNAVKSFSHWP
GLRX5_SCHPO     LDSELNERLSTLTNAHNVMLFLKGTPSEPACGFSRKLVGLLREQNVQYGFFNILADDSVRQGLKVFSDWP
GRS17_ARATH     -EQSLEDRLKALINSSEVMLFMKGSPDEPKCGFSSKVVKALRGENVSFGSFDILTDEEVRQGIKNFSNWP
GRS11_ORYSJ     -EDALNKRLEQLVNSHPVFLFMKGTPEQPRCGFSRKVVDVLKQEGVEFGSFDILTDNDVREGMKKFSNWP
GLRX4_SCHPO     LSTQTRQALEQAVKEDPIVLFMKGTPTRPMCGFSLKAIQILSLENVASDKLNVLSNDELREGIKEFSDWP
GLRX2_RICFE     -----------------VVLFMKGTKEATMCGFSAKVVAILNKLGVEFRDINVFVNPEFREDLKKFSDWP
GLRX5_HUMAN     -----------------------GTPEQPQCGFSNAVVQILRLHGVDYAAYNVLDDPELRQGIKDYSNWP
YCF64_PORPU     MDIETKKVIEQILDNNKIVLFMKGSKLMPMCGFSNTAIQILNTLNTDYFTYDILENENIRQAIKEHSSWP
GLRX5_MOUSE     -----------------------GTPEQPQCGFSNAVVQILRLHGVDYAAYNVLDDPELRQGIKDYSNWP
YCF64_PORYE     MDTETKKRIDQLLNDHKIVLFMKGNKTMPMCGFSNTATQILNTLNIKYFTYDILEDENIRKAIKEYSSWP
GLRX5_DICDI     --------VETQVAESPCILYMKGIPERPECGFSNTAVRILQAEGAVFTSYNVLKNNDMREAVKEFGDWP
GRS16_ARATH     -----EELIDRLVKESKVVAFIKGSRSAPQCGFSQRVVGILESQGVDYETVDVLDDEGLRETLKNYSNWP
GLRX4_BUCAP     --------IERQIKDNIILIYMKGTPQSPSCGFSAQAVQALSICGEKFAYVDILENLDIRKELPRYANWP
GLRX5_YEAST     -----RKAIEDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDFAAYNVLEDPELREGIKEFSEWP
GRXS4_ORYSJ     ---SFDDIVSQDIKENPVLIYMKGYPDAPRCGFSALAVRVLKQYDVPISARDILGDLKLKESVKAHTNWP
GLRX3_DANRE     -------------------LFMKGSPQEPRCGFSRQIIQILKDHNVQYSSFDILSDEEVRQGLKTYSNWP
GRXS1_ORYSJ     ---SFDDIVAQDIKENPVLIYMKGFPESPMCGFSALAVKVLKLYDVPISARDILGDLKLKECVKAHTNWP
GLRX3_HUMAN     -----------------VMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWP
GLRX3_BOVIN     -----------------VMLFMKGNKQEAKCGFSRQILEILNSTGIEYETFDILEDEEVRQGLKAYSNWP
GLRXA_LEGPH     -------------------LYMKGTPKMPQCGFSARAVQCIEACGVDFAYVDILANPDIRQVLPQFSDWP
GLRX3_XENTR     -------------------LFMKGSPQEPRCGFSRQIVALLNDQKVQFSSFDILSDEEVRQGLKTFSNWP
GLRX3_RAT       -----------------VMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWP
GLRX3_MOUSE     -----------------VMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWP
GLRX4_SHIFL     ---TTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWP
GLRX4_ECOLI     ---TTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWP
GLRX4_ECOL6     ---TTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWP
GLRX4_ECO57     ---TTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWP
GLRX3_DICDI     ------------VNQSPVMLFMKGNPEKPQCGFSNKTVTILKENGFEFGSFDILQDQAVRNGLKEYSNWP
GRS12_ORYSJ     -----EQLIDRLVKDNKVVAFIKGSRSAPQCGFSQRVVGILESHGVDFVTVDVLDEEGLRETLKTYSNWP
GLRX4_HAEI8     ----TLDKIKKQISENPILIYMKGSPKLPSCGFSARASEALMHCKVPFGYVDILQHPDIRAELPTYANWP
GLRX4_HAEIN     ----TLDKIKKQISENPILIYMKGSPKLPSCGFPARASEALMHCKVPFGYVDILQHPDIRAELPTYANWP
GLRX4_PASMU     ----TLDKIKKQISENPILIYMKGSPKFPSCGFSARAVEALMHCKVPFGYVDILQHPDIRAELPAYANWP
GLRX4_HAEDU     ----TIDKIKQQINENPILLYMKGSPKFPSCGFSARAVEAIIQCQVPFGYVDILTNPDIRSELPKFANWP
GLRX4_YEAST     ------------VQAAPVMLFMKGSPSEPKCGFSRQLVGILREHQIRFGFFDILRDENVRQSLKKFSDWP
GLRX3_YEAST     -----------------VMLFMKGSPSEPKCGFSRQLVGILREHQVRFGFFDILRDESVRQNLKKFSEWP
GLRX4_BUCAI     --------------------YMKGTPEAPSCGFSAQAVQALSFCGEKFAYVNILENPDIRSELPKYANWP
GLRX4_BUCBP     --------------------YMKGSPDAPSCGFSAQAVHAISSCGKKFAYIDVLKNPDIRLELPKYANWP
TRXR3_MOUSE     ------------IEGNRVMIFSKS-----YCPHSTRVKELFSSLGVVY---NILEGASVQEVLTEISNQK
GRXC1_ARATH     ------------------------------CGYCQRVKQLLTQLGATFKVLELDEMSDIQSALSEWTGQT
YZ73_CAEEL      ----------------------------------------MKIVELDRSN----QTEEMQEILKKYSGRT
GRXC4_ORYSJ     ------------------------------CPFCARVKRLLAELAASYKAVELSDGSELQSALADWTGQR
GRXC2_ARATH     ------------------------------CPYCVRVKELLQQLGAKFKAVELSDGSQIQSGLAEWTGQR
GLRX_VERFO      ------------VSSNSVVVFSKTF-----CPYCTSVKQLLNQLGAQFKVIE-LDSESLQNALAEWTGQR
TRXR3_HUMAN     ----------GLIERSRVVIFSKS-----YCPHSTRVKELFSSLGVE---CNVLELDQVDDGLSEITNQK
GLRX_RICCO      ------------VSSNAVVVFSK-----TYCPYCTSVKKLLDQLGAKYKVVELSDGSEIQTALAEWTGQR
GLRX_SOLLC      ------------VSGNPVAVFSK-----TYCPFCVSVKDLLSKLGATFKAVELKDGSEIQAALAEWTGQR
GRXS6_ORYSJ     ---SPSAFVQNAIYSNRITIFSK-----TYCPYSMRAKRIFRDLKENPYIVELEDGREIQSVLLDLVGRH
GLRX2_BOVIN     ------NQIQETISNNCVVIFSKTS-----CSYCTMAKNLFHDMNVNYKVVDMLEYGSFQDALHKMTGER
GRXC3_ARATH     --------VQNAILSNKIVIFSKSY--CPYCLRSKRIFSQLKVVELDQRE----DGDQIQYELLEFVGRR
GRS12_ARATH     ------------------------------CSYSSQVKSLFKSLQVEPLVVELSEGSQLQNVLEKITGQY
GLRX3_SCHPO     ---------------NPVIIFSR-----PGCPYSAAAKKLLETLRLDPPAVVVEHTQELRDWLSSISDIS
GRS10_ORYSJ     MEDSVKRTLAD----NPVVIYSKSW-----CSYSMEVKALFKRIGVQPHVIELAQGPQLQKVLERLTGQS
GRXC8_ORYSJ     --------VKSTVKAHDVVIFSKSY--CPYCRRAKAVFKELELKKEPY----VVELDQREDGLSDMVGRR
GRXC6_ORYSJ     ------------------------------CPFCVRVKKLFEQLGATFKAIELSDGSELQSALAEWTGQR
GLRX1_RICBR     ------------------------------CPYCMKAKALLDKKEVAYEEIEVQNSQDLRKKLNN-PDRL
GLRX_DICDI      ------------------------------------------------------DGSELQSAAGQISGVR
GLRX2_RAT       ------NQIQETISNNCVVIFSKSS-----CSYCSMAKKIFHDMNVNYKVVEVEYGSQFQEALYKMTGER
GLRX2_PONAB     ------NQIQETISDNCVVIFSKTS-----CSYCTMAKKLFRDMNVNYKVVDLLEGNQFQDALYKMTGGR
GLRX2_MOUSE     ------NQIQETISNNCVVIFSKTS-----CSYCSMAKKIFHDMNVNYKAVDMLEGNQFQDALHKMTGER
GRXC4_ARATH     ------DFVKKTISSHKIVIFSKSY--CPYCKKAKSVFRELDQVPYVVELDEREDGWSIQTALGEIVGRR
GLRX1_PIG       --------VNSKIQPGKVVVFIK--PTCPFCRKTQELLSQLPFKEGLLEFVDITDTNEIQDYLQQLTGAR
GLRXL_DICDI     ---------------------------------------------------------SQRLSIKMFTGFP
GLRX1_RICPR     ------------------------------CPYCIKAKALLDKKNVIYEEIEVLTQEEKEKFIKKSGGKS
GLRX1_BOVIN     --------VNSKIQPGKVVVFIK--PTCPYCRKTQELLSQLPFKQGLLEFVDITAAGNISEYLQQLTGAR
GLRX2_HUMAN     ------NQIQETISDNCVVIFSKTS-----CSYCTMAKKLFHDMNVNYKVVDLLEGNQFQDALYKMTGER
GLRX1_RAT       ------------IQSGKVVVFIK--PTCPYCRKTQEILSQLPFKRGLLEFVDITNTNAIQDYLQQLTGAR
Y5986_ARATH     ----------------------------------------------------------------------
GLRX1_RICTY     ------------------------------CPYCIKAKALLDKKNVIYEEIEVSNTQEEKEAIKKSGGKN
GLRX1_RABIT     -----QEFVNSKIQPGKVVVFIK--PTCPYCRKTQEILSQLPFKQGLLEFVDITATSDMSEYLQQLTGAR
GRCR2_DROME     ------------------------------------VKKILRTLLIKFEERDIFMSVEYQQEMRERMQDE
GRCR1_HUMAN     --------------------------------------------------------KELDERCRRVSEAP
GLRX2_YEAST     -------------------VFVAAKTYCPYC--KATLSTLFQELNVPKSKALVLELDEMSNGLEEISGQK
GRCR1_MOUSE     --------------------------------------------------------KELDERCRRVSEAP
GLRX2_SCHPO     MTSIAKAFVEKAISNNPVTVFSKSF-----CPFCKAAKNTLTKYSAPYKALDKIENGSIQAYLHEKTKQS
GLRX1_MOUSE     ------------IQSGKVVVFIK--PTCPYCRKTQEILSQLPFKQGLLEFVDITNTSAIQDYLQQLTGAR
GRCR1_DROME     ------------------------------------VKQILRTLLVKFEERDVFMSVEYQAEMRQRSGQV
GLRX1_HUMAN     ------------IQPGKVVVFIK--PTCPYCRRAQEILSQLPIKQGLLEFVDITHTNEIQDYLQQLTGAR
GRXS3_ARATH     --------LQKMISEKSVVIFSKNS-----CCMSHTIKTLFLDLGVNYELDEISRGKEIEHALAQLGCSP
GLRX1_RICCN     ----------------------------------------------------------------------
TRXR1_HUMAN     ----SRALLQAYIDGHSVVIFSRST-----CTRCTEVKKLFKSLCVPYFVLELDQTEDGREGLSELAAET
GLRX1_RICFE     ----------------------------------------------------------------------
GRXS4_ARATH     --------LQKMISEKSVVIFSKNS-----CCMSHTIKTLFIDFGVNYELDEINRGKEIEQALAQLGCSP
GRXS5_ARATH     --------LQKMISEKSVVIFSKNS-----CCMSHTIKTLFLDFGVNYELDEINIGREIEQALAQLGCSP
GRXS7_ARATH     ------------------------------CCMSHTIKTLFLDLGVNYELDEINRGKEIEQALAQLGCSP
GRXS2_ARATH     ------------------------------CCMSHTIKTLLCDFGANYELDEISRGREIEQALLRLGCSP
GLRX3_ECOLI     ------------------------------CPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRT
GLRX3_ECOL6     ------------------------------CPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRT
GLRX3_ECO57     ------------------------------CPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRT


                         .         .         *         .         .         .         .:140
query           TIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGINFKK
GLRX2_RICTY     TFPQLYINGELVGGCDIVKELYQNGELEKMLKDE------
GLRX2_RICPR     TFPQLYINGVLVGGCDIAKELYQNGELEKMLKD-------
YC64L_SYNY3     TIPQVYVNGEFVGGSDIMIELYQNGELQEMLE--------
GLRX2_RICCN     TFPQLYINGELVGGCDIARELYQSGELEKMLK--------
GRS14_ARATH     TFPQLYIGGEFFGGCDITLEAFKTGELQEEVE--------
GRXS7_ORYSJ     TFPQLYIDGEFFGGCDITVDAYKSGELQETLE--------
GLRX5_SACKL     TIPQLYVNKEFVGGCDIVMNMAQTG---------------
GRS15_ARATH     TFPQIFIKGEFIGGSDIILNMHKEGELEQKLKD-------
GLRX5_SCHPO     TFPQLYIKGEFVGGLDIVSEMIENGELQEML---------
GRS17_ARATH     TFPQLYYKGELIGGCDIIMELSESGDLKATLSE-------
GRS11_ORYSJ     TFPQLYCKGELLGGCDIVIAMHESGELKDVFKEHNI----
GLRX4_SCHPO     TIPQLYINGEFVGGSDILASMHKSGELHKILKE-------
GLRX2_RICFE     TFPQLYIKGELVGGCDIATELYNNGELEKMLK--------
GLRX5_HUMAN     TIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIH---
YCF64_PORPU     TIPQLYINREFVGGADIMLELFEQGELQAQVE--------
GLRX5_MOUSE     TIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGI----
YCF64_PORYE     TIPQLYINREFIGGADIMLELFETGELQAQVE--------
GLRX5_DICDI     TIPQLYVKGQFIGGADILMGLYKSGELSKLLNEAGV----
GRS16_ARATH     TFPQIFVKGELVGGCDILTSMYENGELANIL---------
GLRX4_BUCAP     TFPQLWIKGELIGGCSIILEMLENGELKKIISNAVLNSK-
GLRX5_YEAST     TIPQLYVNKEFIGGCDVITSMARSG---------------
GRXS4_ORYSJ     TFPQIFIKGEFVGGSDIILDMHQKGQLKDVLGD-------
GLRX3_DANRE     TYPQVYVSGELIGGLDIVKELVESGELE------------
GRXS1_ORYSJ     TFPQIFIKGEFVGGSDIILDMHQKGQLKDVLGD-------
GLRX3_HUMAN     TYPQLYVKGELVGGLDIVKELKENGELLPIL---------
GLRX3_BOVIN     TYPQLYVKGELVGGLDIVKELKENGELLPILK--------
GLRXA_LEGPH     TFPQLYVKGELIGGSDIIAEMFQQGELEPMLRD-------
GLRX3_XENTR     TYPQFYVKGELVGGLDIVKEMVASGELDQM----------
GLRX3_RAT       TYPQLYVRGDLVGGLDIVKELKDNGELLPILK--------
GLRX3_MOUSE     TYPQLYVRGDLVGGLDIVKELKDNGELLPILK--------
GLRX4_SHIFL     TFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYK-
GLRX4_ECOLI     TFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYK-
GLRX4_ECOL6     TFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYK-
GLRX4_ECO57     TFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYK-
GLRX3_DICDI     TYPQLYINGKLVGGYDIIKDLNEEGEL-------------
GRS12_ORYSJ     TFPQVFVGGELVGGCDIVSSMAEKGEL-------------
GLRX4_HAEI8     TFPQLWVEGELIGGCDIILEMYQAGELQTLLAE-------
GLRX4_HAEIN     TFPQLWVEGELIGGCDIILEMYQAGELQTLLAE-------
GLRX4_PASMU     TFPQLWVDGELVGGCDIILEMFQQGELQTLLAD-------
GLRX4_HAEDU     TFPQLWVEGELIGGCDIILEMFQKGELHTLLKE-------
GLRX4_YEAST     TFPQLYINGEFQGGLDIIKESIE-----------------
GLRX3_YEAST     TFPQLYINGEFQGGLDIIKESLE-----------------
GLRX4_BUCAI     TFPQLWIDGELIGGCSIILEMLENGE--------------
GLRX4_BUCBP     TFPQLWVNGELIGGCNIILELFQKGELKKTI---------
TRXR3_MOUSE     TVPNIFVNKVHVGGCDRTFQAHQNGLLQKLLQD-------
GRXC1_ARATH     TVPNVFIKGNHIGGCDRVMETNKQGKLVPLLTEAG-----
YZ73_CAEEL      TVPQLFISGKFVGGHDETKAIEEKGELRPLLE--------
GRXC4_ORYSJ     TVPCVFIKGKHIGGCDDTMAMHKGGNLVPLLTEAG-----
GRXC2_ARATH     TVPNVFIGGNHIGGCDATSNLHKDGKLVPLLTEAG-----
GLRX_VERFO      TVPNVFIGGKHIGGCDKTTGMHQEGKLIPLLTEAG-----
TRXR3_HUMAN     TVPNIFVNKVHVGGCDQTFQAYQSGLLQKLLQE-------
GLRX_RICCO      TVPNVFIGGKHIGGCDSTTAKHSQGQLVPLLTEAG-----
GLRX_SOLLC      TVPNVFIGRKHIGGCDATTALHREGKLLPLLTEAG-----
GRXS6_ORYSJ     TVPQVFVNGQHVGGSDDTANAHSNGQLQKLL---------
GLRX2_BOVIN     TVPRIFVNGTFIGGATDTHRLHKEGKL-------------
GRXC3_ARATH     TVPQVFVNGKHIGGSDDLGAALESGQLQKLL---------
GRS12_ARATH     TVPNVFIGGKHIGGCSDTLQLHNKGELEAILAE-------
GLRX3_SCHPO     TMPNIFVGGHSIGGSDSVRALYQEEKLQSTLDE-------
GRS10_ORYSJ     TVPNVFIGGKHIGGCTDTVKLHRKGELATMLSELDID---
GRXC8_ORYSJ     TVPQVFVHGKHLGGSDDTVEAYESGKLAKLL---------
GRXC6_ORYSJ     TVPNVFINGKHIGGCDDTLALNNEGKLVPLLTE-------
GLRX1_RICBR     TFPQIFIDNMHIGGCDDLYDLDKEGRLDKLLE--------
GLRX_DICDI      TVPQVFINEKFIGGCDATTKLHSQGKLIPLLQEAG-----
GLRX2_RAT       TVPRIFVNGIFIGGAADTHRLHKEGKLLPLVHQCYLNKSK
GLRX2_PONAB     TVPRIFVNGTFIGGATDTHRLHKEGKL-------------
GLRX2_MOUSE     TVPRIFVNGRFIGGAADTHRLHKEGKL-------------
GRXC4_ARATH     TVPQVFINGKHLGGSDDTVDAYESGELAKLLGVSG-----
GLRX1_PIG       TVPRVFIGKECIGGCTDLESMHKRGELLTRLQQIG-----
GLRXL_DICDI     TYPQVFVDGTLIGGCDTIKELNEGNDLKK-----------
GLRX1_RICPR     TVPQIFIDNMHVGGCDDLFNLEKEGRLDKLLEHQPKN---
GLRX1_BOVIN     TVPRVFIGQECIGGCTDLVNMHERGELLTRLKQMG-----
GLRX2_HUMAN     TVPRIFVNGTFIGGATDTHRLHKEGKL-------------
GLRX1_RAT       TVPRVFIGKDCIGGCSDLLSMQQNGELTARLKQIG-----
Y5986_ARATH     TLPRVFLGNKYLGGVEEIKKLNENGELEKLIKD-------
GLRX1_RICTY     TVPQIFIDNMHVGGCDDLFNLEQDGRLDKLLETQPKN---
GLRX1_RABIT     TVPRVFLGKDCIGGCSDLIAMQEKGELLARLKEMG-----
GRCR2_DROME     TIPQLFVEGQLIGDANIVERLNESGELRQLL---------
GRCR1_HUMAN     SLPVVFIDGHYLGGAEKILSMNESGELQDIL---------
GLRX2_YEAST     TVPNVYINGKHIGGNSDLETLKKNGKLAEILK--------
GRCR1_MOUSE     SLPVVFIDGHYLGGAEKILSMNESGELQDLL---------
GLRX2_SCHPO     TVPSIFFRNQFIGGNSDLNKLRSSGTLTKMIAE-------
GLRX1_MOUSE     TVPRVFIGKDCIGGCSDLISMQQTGELMTRLKQIG-----
GRCR1_DROME     RVPQLYVEGQHIGDAETVERMNESGELRQLLK--------
GLRX1_HUMAN     TVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIG-----
GRXS3_ARATH     TVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAG-----
GLRX1_RICCN     TVPQIFIDNMHVGGCDALFDLEKEGRLDKLLENQ------
TRXR1_HUMAN     DLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNG-----
GLRX1_RICFE     TVPQIFIDNIHVGGCDALFDLEKEGRLDKLLE--------
GRXS4_ARATH     TVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRVG-----
GRXS5_ARATH     TVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAG-----
GRXS7_ARATH     TVPVVFIGGQLVGGANQVMSLHLNRSLIPMLKRVG-----
GRXS2_ARATH     AVPGVFIGGELVGGANEVMSLHLNGSLIPMLKRAG-----
GLRX3_ECOLI     TVPQIFIDAQHIGGCDDLYALDARGGLDPLLK--------
GLRX3_ECOL6     TVPQIFIDAQHIGGCDDLYALDARGGLDPLLK--------
GLRX3_ECO57     TVPQIFIDAQHIGGCDDLYALDARGGLDPLLK--------