[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21961.1

[Show Plain Result]


## Summary of Sequence Search
    1::337
   46::374     2e-79  47%  376 aa  RIR2_IIV3 RecName: Full=Probable ribonucleoside-diphosphate
    1::357     1e-76  48%  360 aa  RIR2_IIV6 RecName: Full=Probable ribonucleoside-diphosphate
   33::346     5e-37  31%  346 aa  RIR2_CHLTR RecName: Full=Ribonucleoside-diphosphate reductase
   33::346     2e-36  32%  346 aa  RIR2_CHLMU RecName: Full=Ribonucleoside-diphosphate reductase
   13::341     1e-35  31%  346 aa  RIR2_CHLPN RecName: Full=Ribonucleoside-diphosphate reductase
   38::345     2e-27  29%  351 aa  RIR2_TREPA RecName: Full=Ribonucleoside-diphosphate reductase
   36::344     2e-24  28%  345 aa  RIR2_BACHD RecName: Full=Ribonucleoside-diphosphate reductase
   25::295     3e-23  29%  312 aa  RIR2_RSIV RecName: Full=Ribonucleoside-diphosphate reductase small
    4::307     7e-23  28%  327 aa  RIR2_ASFP4 RecName: Full=Ribonucleoside-diphosphate reductase small
   16::307     2e-22  28%  327 aa  RIR2_ASFK5 RecName: Full=Ribonucleoside-diphosphate reductase small
    4::307     3e-22  28%  327 aa  RIR2_ASFWA RecName: Full=Ribonucleoside-diphosphate reductase small
    4::307     3e-22  28%  327 aa  RIR2_ASFM2 RecName: Full=Ribonucleoside-diphosphate reductase small
   11::314     1e-21  28%  334 aa  RIR2_ASFB7 RecName: Full=Ribonucleoside-diphosphate reductase small
    7::335     2e-21  26%  341 aa  RIR2_HELPJ RecName: Full=Ribonucleoside-diphosphate reductase
    7::335     7e-21  26%  341 aa  RIR2_HELPY RecName: Full=Ribonucleoside-diphosphate reductase
   23::342     3e-20  27%  351 aa  RIR2B_MOUSE RecName: Full=Ribonucleoside-diphosphate reductase
    6::307     2e-19  28%  325 aa  RIR2_YLDV RecName: Full=Ribonucleoside-diphosphate reductase small
    7::320     2e-19  29%  338 aa  RIR2_DICDI RecName: Full=Ribonucleoside-diphosphate reductase small
   19::324     4e-19  28%  337 aa  RIR2_TRYBB RecName: Full=Ribonucleoside-diphosphate reductase small
   46::342     4e-19  27%  351 aa  RIR2B_MACFA RecName: Full=Ribonucleoside-diphosphate reductase
    4::314     5e-19  28%  319 aa  RIR2_VACCW RecName: Full=Ribonucleoside-diphosphate reductase small
    4::314     6e-19  27%  319 aa  RIR2_VACCA RecName: Full=Ribonucleoside-diphosphate reductase small
   70::389     8e-19  27%  410 aa  RIR2_NEUCR RecName: Full=Ribonucleoside-diphosphate reductase small
   45::332     1e-18  26%  349 aa  RIR2_PLAF4 RecName: Full=Ribonucleoside-diphosphate reductase small
    4::314     1e-18  27%  319 aa  RIR2_VACCP RecName: Full=Ribonucleoside-diphosphate reductase small
    4::314     2e-18  28%  319 aa  RIR2_VACCC RecName: Full=Ribonucleoside-diphosphate reductase small
   33::321     3e-18  28%  341 aa  RIR2A_ARATH RecName: Full=Ribonucleoside-diphosphate reductase
   21::304     2e-17  25%  319 aa  RIR4_ECOLI RecName: Full=Ribonucleoside-diphosphate reductase 2
   69::377     2e-17  26%  386 aa  RIR2_DANRE RecName: Full=Ribonucleoside-diphosphate reductase
   50::380     2e-17  29%  389 aa  RIR2_HUMAN RecName: Full=Ribonucleoside-diphosphate reductase
    7::308     2e-17  27%  325 aa  RIR2_ENCCU RecName: Full=Ribonucleoside-diphosphate reductase small
   21::310     2e-17  26%  333 aa  RIR2B_ARATH RecName: Full=Putative ribonucleoside-diphosphate
    4::314     3e-17  26%  319 aa  RIR2_VARV RecName: Full=Ribonucleoside-diphosphate reductase small
   16::305     3e-17  25%  322 aa  RIR2_PLAFG RecName: Full=Ribonucleoside-diphosphate reductase small
   84::387     3e-17  24%  399 aa  RIR2_YEAST RecName: Full=Ribonucleoside-diphosphate reductase small
   21::313     4e-17  25%  329 aa  RIR2_TOBAC RecName: Full=Ribonucleoside-diphosphate reductase small
   73::381     6e-17  28%  390 aa  RIR2_MOUSE RecName: Full=Ribonucleoside-diphosphate reductase
   72::380     1e-16  28%  389 aa  RIR2_MACFA RecName: Full=Ribonucleoside-diphosphate reductase
   73::372     4e-16  27%  386 aa  RIR2_MESAU RecName: Full=Ribonucleoside-diphosphate reductase
   13::340     4e-16  25%  376 aa  RIR2_BUCBP RecName: Full=Ribonucleoside-diphosphate reductase
   37::310     5e-16  26%  325 aa  RIR2_MYCLE RecName: Full=Ribonucleoside-diphosphate reductase
   46::342     6e-16  25%  351 aa  RIR2B_PONAB RecName: Full=Ribonucleoside-diphosphate reductase
   46::342     6e-16  25%  351 aa  RIR2B_HUMAN RecName: Full=Ribonucleoside-diphosphate reductase
   85::381     8e-16  26%  390 aa  RIR2_RAT RecName: Full=Ribonucleoside-diphosphate reductase subunit
   21::315     1e-15  25%  319 aa  RIR4_SALTY RecName: Full=Ribonucleoside-diphosphate reductase 2
   41::313     2e-15  25%  320 aa  RIR2_EHV4 RecName: Full=Ribonucleoside-diphosphate reductase small
   21::314     2e-15  24%  332 aa  RIR2C_ARATH RecName: Full=Ribonucleoside-diphosphate reductase
   30::332     3e-15  27%  345 aa  RIR2_LEIAM RecName: Full=Ribonucleoside-diphosphate reductase small
   42::314     3e-15  26%  321 aa  RIR2_EHV1B RecName: Full=Ribonucleoside-diphosphate reductase small
   71::375     3e-15  27%  393 aa  RIR2_DROME RecName: Full=Ribonucleoside-diphosphate reductase
   45::363     7e-15  24%  384 aa  RIR2_SPISO RecName: Full=Ribonucleoside-diphosphate reductase small
   34::315     9e-15  27%  322 aa  RIR2_MYCTU RecName: Full=Ribonucleoside-diphosphate reductase
   30::313     5e-14  27%  329 aa  RIR2_BACSU RecName: Full=Ribonucleoside-diphosphate reductase
   96::403     1e-13  24%  417 aa  RIR2_MIMIV RecName: Full=Ribonucleoside-diphosphate reductase small
    4::340     1e-13  25%  376 aa  RIR2_HAEIN RecName: Full=Ribonucleoside-diphosphate reductase
    4::340     3e-13  25%  376 aa  RIR2_SALTY RecName: Full=Ribonucleoside-diphosphate reductase 1
    4::340     3e-13  25%  376 aa  RIR2_ECOLI RecName: Full=Ribonucleoside-diphosphate reductase 1
    4::340     3e-13  25%  376 aa  RIR2_ECO57 RecName: Full=Ribonucleoside-diphosphate reductase 1
   94::363     4e-13  24%  381 aa  RIR2_CAEEL RecName: Full=Ribonucleoside-diphosphate reductase small
   44::342     4e-12  25%  376 aa  RIR2_BUCAI RecName: Full=Ribonucleoside-diphosphate reductase
   25::228     6e-11  25%  696 aa  RIR2_AQUAE RecName: Full=Ribonucleoside-diphosphate reductase
   55::332     2e-10  23%  337 aa  RIR2_HHV2H RecName: Full=Ribonucleoside-diphosphate reductase small
   55::332     2e-10  23%  337 aa  RIR2_HHV23 RecName: Full=Ribonucleoside-diphosphate reductase small
   44::342     2e-10  23%  376 aa  RIR2_BUCAP RecName: Full=Ribonucleoside-diphosphate reductase
   24::296     5e-10  22%  303 aa  RIR2_SUHVK RecName: Full=Ribonucleoside-diphosphate reductase small
   55::269     2e-09  26%  274 aa  RIR2_SWPVK RecName: Full=Ribonucleoside-diphosphate reductase small
   80::369     2e-09  22%  391 aa  RIR2_SCHPO RecName: Full=Ribonucleoside-diphosphate reductase small
   70::368     2e-09  22%  579 aa  RIR2_OSHV1 RecName: Full=Ribonucleoside-diphosphate reductase small
   27::327     6e-09  22%  345 aa  RIR4_YEAST RecName: Full=Ribonucleoside-diphosphate reductase small
   37::307     1e-07  23%  314 aa  RIR2_BHV1C RecName: Full=Ribonucleoside-diphosphate reductase small
   30::299     2e-07  22%  306 aa  RIR2_VZVO RecName: Full=Ribonucleoside-diphosphate reductase small
   30::299     2e-07  22%  306 aa  RIR2_VZVD RecName: Full=Ribonucleoside-diphosphate reductase small
   41::332     3e-07  21%  339 aa  RIR2_MYCGA RecName: Full=Ribonucleoside-diphosphate reductase
   48::352     1e-06  24%  388 aa  RIR2_BPT4 RecName: Full=Ribonucleoside-diphosphate reductase
  219::335     3e-06  27%  340 aa  RIR2_HHV1K RecName: Full=Ribonucleoside-diphosphate reductase small
  219::335     3e-06  27%  340 aa  RIR2_HHV11 RecName: Full=Ribonucleoside-diphosphate reductase small
   42::133     5e-05  28%  340 aa  RIR2_MYCGE RecName: Full=Ribonucleoside-diphosphate reductase
   41::132     3e-04  25%  339 aa  RIR2_MYCPN RecName: Full=Ribonucleoside-diphosphate reductase
    1::337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxTKIIQPPKEEIVKPQKMGLLVENPVYKPFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQKNLTQSE
RIR2_IIV3       --------------------LMADRTTFKPFEYPGCYDKWDTHEHAHWSFKELNMQDDVHDWHNRLSEAE
RIR2_IIV6       ------------------MSLLKGRNYYKPFTYPEFYNKWDKHEKSHWLPSEVPMHDDVNDWKNRLNDNQ
RIR2_CHLTR      -----------------------------PIKYKWAWEHYLNGCANNWLPTEIPMGKDIELWKSDLSEDE
RIR2_CHLMU      -----------------------------PIKYKWAWEHYLNGCANNWLPTEISMGKDIELWKSNLSEDE
RIR2_CHLPN      -------------VEVSKKGLVNCNQVLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIELWKSDLSEDE
RIR2_TREPA      ---------------------------FNNMKYPWVSKWYRQAMNNFWIPEEINMSSDVQDY-RNLSAIE
RIR2_BACHD      -------------------------------RFSWAYPLYKNMLANFWTPFEINMSHDAKQFP-TLTETE
RIR2_RSIV       -----------------------------------------------WTVEEVDLSTDVRHWTDKLTEAE
RIR2_ASFP4      --------------------LLIENSTIFPIQHPECWNWYKKLESLTWTAQEVDMCKDIDDWEA-MPKSQ
RIR2_ASFK5      -----------------------------PIQHPECWNWYKKLESLTWTAQEVDMCKDIDDWEA-MPKPQ
RIR2_ASFWA      --------------------LLIENSTIFPIQHPECWNWYKKLESLTWTAQEVDMCKDIDDWEA-MPKPQ
RIR2_ASFM2      --------------------LLIENSTIFPIQHPECWNWYKKLESMTWTAQEVDMCKDIDDWEA-MPKPQ
RIR2_ASFB7      --------------------LLIENSTIFPIQHPECWNWYKKLESLTWTAQEVDMCKDIDDWEA-MPKPQ
RIR2_HELPJ      ---KIYNPNSTESVNERK--IFGGNPTLNKIKYQWADHLWKTMLANTWFAEEVSMNDDKRDYLK-LSAEE
RIR2_HELPY      ---KIYNPNSTESVNERK--IFGGNPTLNKIKYQWADHLWKTMLANTWFAEEVSMNDDKRDYLK-LSAEE
RIR2B_MOUSE     ---------EENVVRSNEEPLLRKSSVIFPIQYPDIWRMYKQAQASFWTAEEVDLSKDLPHWNK-LKSDE
RIR2_YLDV       ----------EPILKPTLNKYVVFPIVYE--------DIWKMYKKAFWTVEEVDLSKDFSDWLK-LSDNE
RIR2_DICDI      ---------KDTFIEP----ILKENKVLFPIKYPDIWRMYKKALASHWVAEEIDLGNDNVDWEYKLTDNE
RIR2_TRYBB      --------------------LLTENPVIFPIKYPDIWQKYKEAESSIWTVEEIDLGNDMTDWEK-LDDGE
RIR2B_MACFA     -----------------------------PIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNK-LKADE
RIR2_VACCW      --------------------ILAPNPVIFPIQY---YDIWNMYKKAEWTVEEVDISKDINDWNK-LTPDE
RIR2_VACCA      --------------------ILAPNPVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDWNK-LTPDE
RIR2_NEUCR      -------------LKPEEANLLTENPVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWNNRLNDDE
RIR2_PLAF4      -----------------------------PILYPDVWDFYKKAEASFWTAEEIDLSSDLKDFEK-LNENE
RIR2_VACCP      --------------------ILAPNPVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDWNK-VTPDE
RIR2_VACCC      --------------------ILAPNPVIFPIQY---YDIWNMYKKAEWTVEEVDISKDINDWNK-LTPDE
RIR2A_ARATH     -----------------------------PIRYKSIWEMYKKAEASFWTAEEVDLSTDVQQWEA-LTDSE
RIR4_ECOLI      -------------------------------------EVWNRLTSNFWLPEKVPLSNDIPAWQ-TLTVVE
RIR2_DANRE      --------------------LLKENPVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWD-SLKDEE
RIR2_HUMAN      ---RIFQEPTEPKTKAAAPGLLRENPVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE-SLKPEE
RIR2_ENCCU      --TELLLDPKEERF------------VLLPIKYHDIWKMYKKAESSFWTVEEVSLDKDIDDWGK-LNAKE
RIR2B_ARATH     -----------------------------PIQYPQIWEMYKKAEASFWTAEEVDLSQDNRDWENSLTNDE
RIR2_VARV       --------------------ILAKNPVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDWNK-LTPDE
RIR2_PLAFG      -----------------------------PILYPDVFPFYKKAEACFWTAEEIDYSSDLKDFEK-LNENE
RIR2_YEAST      -----------------------ERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWNNRMNENE
RIR2_TOBAC      -----------------------------PIQYPQIWEMYKKALASFWTAEEVDLSSDTRHWE-TLTPGE
RIR2_MOUSE      --------------------LLRENPVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA-LKPDE
RIR2_MACFA      --------------------LLRENPVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE-SLKPEE
RIR2_MESAU      --------------------LLRENPVVFPIEYHDIWKMYKKAEASFWTAEEVDLSKDIQHWEA-LKPDE
RIR2_BUCBP      -----------QLYEPMFFGQSVNISRYDQQKYEIFEKLIEKQLSFFWRPEEVDLSRDYIDFQ-NLPQHE
RIR2_MYCLE      -----------------------------------------------WLPEKVPVSNDLPSWG-TLTASE
RIR2B_PONAB     -----------------------------PIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNK-LKADE
RIR2B_HUMAN     -----------------------------PIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNK-LKADE
RIR2_RAT        -----------------------------PIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA-LKPDE
RIR4_SALTY      -------------------------------------EVWNRLTSNFWLPEKVPLSNDIPAWQ-TLSAAE
RIR2_EHV4       -----------------------------------------------WLDTDLPISDDLKDVAK-LAPAE
RIR2C_ARATH     -----------------------------PIHYPQIWEMYKKAEASFWTAEEVDLSQDNRDWENSLNDGE
RIR2_LEIAM      -----------------------ENPVLFPIQYHDIWRKYKEQESCIWTVEEIDLGNDMKDW-ATLNDGE
RIR2_EHV1B      -----------------------------------------------WLDTDLPISDDLKDVAK-LTPAE
RIR2_DROME      ---------------PSLEPLLRENPVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLTDWHR-LKDDE
RIR2_SPISO      --TPLKQEIKPVVKKSQQVELLADNPVVLPIQYHDIWKMYKKAEASFWTAEEVDLSKDMAHWE-SLKKEE
RIR2_MYCTU      -----------------------------------------------WLPEKIPLSNDLASWQ-TLSSTE
RIR2_BACSU      -----------------------------------------------WLPEEIALNGDLLTW-KYLGKNE
RIR2_MIMIV      ------------IMKEPILSLKSEQYTVHPIKYQKVWDNYKDQMKNYWTVEEVDLAKDVNDWNNHLSDDD
RIR2_HAEIN      --TTFSQNKNDQLKEPMFFGQNVNVARYDQQKYETFEKLIEKQLSFFWRPEEVDVSQDRIDYAA-LPEHE
RIR2_SALTY      --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
RIR2_ECOLI      --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
RIR2_ECO57      --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
RIR2_CAEEL      -----------------------------------------------WTVEEVDLGKDMNDWEK-MNGDE
RIR2_BUCAI      ------------------------------------------QLSFFWRPEEIDLSRDRIDFQ-NLPDNE
RIR2_AQUAE      ---------KRKIIKGNPTNIFELNEI----KYSWAFDLYLMGFTNFWIPEEIQMLEDRKQYETVLSDYE
RIR2_HHV2H      -----------------------------------------------WLETELVFVGDEEDVSK-LSEGE
RIR2_HHV23      -----------------------------------------------WLETELVFVGDEEDVSK-LSEGE
RIR2_BUCAP      ------------------------------------------QLSFFWRPEEIDLSKDRIDFD-NLPSNE
RIR2_SUHVK      -----------------------------------------------WLETDLPLGDDAKDVAA-LSEPE
RIR2_SWPVK      ---------------------------------------------------------------------E
RIR2_SCHPO      -----------------------------PIKYHEIWQFYKKAEASFWTAEEIDLSKDLVDWDNKLNADE
RIR2_OSHV1      -----------------------DHALLKPAVYQQLRDFATKMESSSWQQTEIDAESDIPTWEQ-ISENE
RIR4_YEAST      --------------------LLMENSVMFPIKYHEIWAAYKKVEASFWTAEEIELAKDTEDFQK-LTDDQ
RIR2_BHV1C      -----------------------------------------------WLETEFPLADDAKDVAR-LSGAE
RIR2_VZVO       -----------------------------------------------WLESDFIIEDDYQ-YLDCLTEDE
RIR2_VZVD       -----------------------------------------------WLESDFIIEDDYQ-YLDCLTEDE
RIR2_MYCGA      -------------------------------------EVWTRVTQNFWLPEKIPVSNDLKSWNE-LTPEW
RIR2_BPT4       -----------------------------------------------WRPEEVNLMMDAAQFNK-LPQYQ
RIR2_HHV1K      ----------------------------------------------------------------------
RIR2_HHV11      ----------------------------------------------------------------------
RIR2_MYCGE      -------------------------------------EVWNRIVQNFWLPEKIPVSNDIPSWKK-LSKDW
RIR2_MYCPN      -------------------------------------EVWNRITQNFWLPEKIPVSNDIPSW-KQLSKEW


                         .         .         *         .         .         .         .:140
query           KNLLTQIFRFFTQADVEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEYSAF
RIR2_IIV3       KTFLVQILRFFTQGDVDVAVGYVQ-YLQLFQQPEVRMMLFSFGAREAMHIASYSHLISTLNLPDVTYQEF
RIR2_IIV6       RDFLTNIFRFFTQGDVDVASAYYTQYLPFFKLPEVTMMMGGFAGREGVHIDAYSYLLETLGMPEATYKEF
RIR2_CHLTR      RRVILLNLGFFSTAESLVNNIVLAIFKHVTNP-EARQYLLRQAFEEAVHTHTFLYICESLGLDEKEIDDF
RIR2_CHLMU      RRVILLNLGFFSTAESLVNNIVLAIFKHVTNP-EARQYLLRQAFEEAVHTHTFLYICESLGLDEKEIDDF
RIR2_CHLPN      RRVILLNLGFFSTAESLVNNIVLAIFKHITNP-EARQYLLRQAFEEAVHTHTFLYICESLGLDEGEFNAY
RIR2_TREPA      KTAYDKILSFLIFLD-SIQTANLPNIGQYITANEINLCLTIQAFQEAVHSQSYSYMLDTICSPEERNDIL
RIR2_BACHD      QEAFKKIIGLLAFLD-SVQTDYSMRAAEYLTDSSLAALMSVLSFQEVVHNQSYSYVLSSL-VPKATQDEI
RIR2_RSIV       RRFMSHILAFFAMADGIVGDNLVCNFA---KELDHIPEARAFVAIENIHAEMYTQLIITLVAKENQAALF
RIR2_ASFP4      REFYKQILAFFVVADEIVIENLLTNFMREIKVKEVLYFYTMQAAQECVHSEAYSIQVKTLIPDEKEFSGI
RIR2_ASFK5      REFYKQILAFFVVADEIVIENLLTNFMREIKVKEVLYFYTMQAAQECVHSEAYSIQVKTLIPDEKEFSGI
RIR2_ASFWA      REFYKQILAFFVVADEIVIENLLTNFMREIKVKEVLYFYTMQAAQECVHSEAYSIQVKTLIPDEKEFSGI
RIR2_ASFM2      REFYKQILAFFVVADEIVIENLLTNFMREIKVKEVLYFYTMQAAQECVHSEAYSIQVKTLIPDEKEFSGI
RIR2_ASFB7      REFYKQILAFFVVADEIVIENLLTNFMREIKVKEVLYFYTMQAAQECVHSEAYSIQVKTLIPDEKEFSGI
RIR2_HELPJ      KIGYDRALAQLIFMDSLQANNLIDNINPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEYDMW
RIR2_HELPY      KIGYDRALAQLIFMDSLQANNLIDNINPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEYDMW
RIR2B_MOUSE     KYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTIRDPKKRFNAI
RIR2_YLDV       KNFIKHILAFFAASDGIVNENLAERFYSEVQISEARCFYGFQIAMENIHSEMYSLLIDTYILDSKEFNAI
RIR2_DICDI      RHFISHVLAFFAASDGIVNENLATRFMSEVQIPEARCFYGFQIAIENIHSETYSLLIETIKDKQTKDKLF
RIR2_TRYBB      RHFIKHVLAFFAASDGIVLENLAERFMCEVQVPEVRCFYGFQIAMENIHSETYSVLIDTYVVDPDEKQRL
RIR2B_MACFA     KYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTIRDPKKRFNAI
RIR2_VACCW      KYFIKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKDSNEKNYL
RIR2_VACCA      KYFIKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKDSNEKNYL
RIR2_NEUCR      KFFISHILAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETYSLLIDTYIKEPSQRTYL
RIR2_PLAF4      KHFIKHVLAFFAASDGIVLENLASKFLREVQITEAKKFYSFQIAVENIHSETYSLLIDNYIKDEKEFHAI
RIR2_VACCP      KYFIKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFRMAIENIHSEMYSLLIDTYVKDSNEKNYL
RIR2_VACCC      KYFIKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKDSNEKNYL
RIR2A_ARATH     KHFISHILAFFAASDIVLENLAARFLNDVQVP-EARAFYGFQIAMENIHSEMYSLLLETFIKDSKEFNAI
RIR4_ECOLI      QQLTMRVFTGLTLLDT-LQNVIGAPMPDALTPHEEAVLSN-ISFMEAVHARSYSSIFSTLCQTKDVDAAY
RIR2_DANRE      RYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEFNAI
RIR2_HUMAN      RYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTIKDPKEREFLF
RIR2_ENCCU      RHFISYVLAFFAASDGIVNLNLVERFSTEVKVLEARFFYGFQMAIENIHSEMYSLLIDTYIRDNDEFDAI
RIR2B_ARATH     RHFIKHVLAFFAASDIVLENLSTRFMSDV-QISEARAFYGFQIAIENIHSEMYSLLLDTYIKDNKERDHL
RIR2_VARV       KYFIKHVLAFFAASDGIVNENLAERFCIEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKDSNEKNYL
RIR2_PLAFG      KHFIKHVLAFFAASDGIVLENLAVSFLREVQITEAKKFYSFQIAVENIHSETYSLLIDNYIKDEKEFHAI
RIR2_YEAST      RFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYDPKESEFNAI
RIR2_TOBAC      RHFITHVLAFFAASDGIVLENLAGRFMKEVQVAEARAFYGFQIAIENIHSEMYSLLLESYIKDSDEKSRL
RIR2_MOUSE      RHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTIKDPKEREYLF
RIR2_MACFA      RYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTIKDPKEREFLF
RIR2_MESAU      RHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREYL
RIR2_BUCBP      KHIFVSNLKYQTLLDIQGRSPNIALLPIVSLP-ELETWIETWSFSETIHSRSYTHIIRNIINTPSELTSY
RIR2_MYCLE      KQLTMRVFTGLTLLDT-IQGTVVSLIPDALTPHEEAVY-TNIAFMESVHAKSYSSIFSTLCSTAEIDEAF
RIR2B_PONAB     KYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTIRDPKKRFNAI
RIR2B_HUMAN     KYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTIRDPKKRFNAI
RIR2_RAT        RHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREYL
RIR4_SALTY      QQLTIRVFTGLTLLDT-IQNIAPSLMADAITPHEE-AVLSNISFMEAVHARSYSSIFSTLCQTKEVDAAY
RIR2_EHV4       REFYRFLFAFLSAAD-DLVNLNLGDLSALFTQKDILHYYIEQESIEVTHSRVYSALFGNDATARARYVAS
RIR2C_ARATH     RHFIKHVLAFFAASDGIVLENLASRFMSDVQVSEARAFYGFQIAIENIHSEMYSLLLDTYIKDNKERDHL
RIR2_LEIAM      RHFIKHVLAFFAGSDGIVIENLAQRFMSDVKVPEARAFYGFQLMMENIHSETYSVLLDTYITDSEEKLRL
RIR2_EHV1B      REFYRFLFAFLSAAD-DLVNLNLGDLSALFTQKDILHYYIEQESIEVTHSRVYSAIQLMLFGNDAAARAR
RIR2_DROME      RHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENVHSEMYSVLIDTIRDPHQREYLF
RIR2_SPISO      KHFISHVLAFFAASDGIVNENLVERFSKEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPQEFNAI
RIR2_MYCTU      QQTTIRVFTGLTLLDAQATVGAVAMIDDAVTPHEE-AVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAF
RIR2_BACSU      QDTYMKVLAGLTLLDTEQGNTGMPIVAEHVDGHQRKAVLNFMAMMENVHAKSYSNIFMTLAPTETINEVF
RIR2_MIMIV      RNFIMHVLAFFAAADGIVNANIKENLIDVVKIKEAECAYGFQYAMENAHGEMYSLMLTTFVKDDALRNKL
RIR2_HAEIN      KHIFISNLKYQTLLDIQGRSPNVALLPLVSIP-ELETWIETWTFSETIHSRSYTHIIDIVTNEEIIKRAQ
RIR2_SALTY      KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSYTHIINIVNDPAVVFDDI
RIR2_ECOLI      KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSYTHIIRNIVNDPSEMTSY
RIR2_ECO57      KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSYTHIIRNIVNDPSEMTSY
RIR2_CAEEL      QYFISRILAFFAASDGIVNENLCERFSNEVQVSEARFFYGFQIAIENIHSEMYSKLIETYIRDETEFNAV
RIR2_BUCAI      KHIFISNLKYQTLLDSIQGRSPNIAFLPIISIPELETWIETWSFSETIHSRSYTHIIRNIVNCPS--LVF
RIR2_AQUAE      KRAYELVLSFLIALD-SFQVDMLKEFGRMITAPEVEMAITAQEFQESVHAYSYQFILESVVDPVKADEIY
RIR2_HHV2H      LGFYRFLFAFLSAADDLVTE-NLGGLSGLFEQKDILHYYVEQECIEVVHSRVYN-IIQLVLFHNNDQARR
RIR2_HHV23      LGFYRFLFAFLSAADDLVTE-NLGGLSGLFEQKDILHYYVEQECIEVVHSRVYN-IIQLVLFHNNDQARR
RIR2_BUCAP      KHIFISNLKYQTLLDSIQGRSPNIAFLPIVSIPELETWIETWSFSETIHSRSYTHIINIINNPSSIYYDE
RIR2_SUHVK      LEFYRFLFAFLSAAD-DLVNVNLGSLSELFTQKDILHYYIEQECIEVVHSRVYSAIQLMLFRGDAAARER
RIR2_SWPVK      KYFIKHILAFFASSDGIVNENLAERFYVDVQCSEARCFYGFQIAMENIHSEMYSLLIDTYVRDNIEFNAI
RIR2_SCHPO      RYFISTVLAYFAASDGIVNENLLERFSSEVQIPEARCVYGFQIMIENIHSETYSLLLDTIREPKEKFDAI
RIR2_OSHV1      RDCVRKVLAFFAVGDTLVKD-RIAIFADEFPLPECKDFIDWQTVNEGVHQRVYNNYLDALVKDKIYLADL
RIR4_YEAST      KTYIGNLLALSISSDNLVNKYLIENFSAQLQNPEGKSFYGFQIMMENIYSEVYSMMVDAFFKDPKNIPLF
RIR2_BHV1C      LEFYRFLFAFLSAAD-DLVNVNLGDLSELFTQKDILHYYIEQESIEVVHSRVYS-AIQLLLFRNDAVARA
RIR2_VZVO       LIFYRFIFTFLSAAD-DLVNVNLGSLTQLFSQKDIHHYYIEQECIEVVHARVYSQIQLMLFRGDESLRVQ
RIR2_VZVD       LIFYRFIFTFLSAAD-DLVNVNLGSLTQLFSQKDIHHYYIEQECIEVVHARVYSQIQLMLFRGDESLRVQ
RIR2_MYCGA      KQLVTRTFTGLTLLDAQIPNSLTDHEQFVY---------ANFSFMVGVHARSYGTIFSTLNTSDEIEEAH
RIR2_BPT4       QNIFTNNLKYQSLLDSIQGRAPSAVLMSLISDPSLDTWVATWTFSETIHSRSYTHIMDEIVLDEAEY--Y
RIR2_HHV1K      ----------------------------------------------------------------------
RIR2_HHV11      ----------------------------------------------------------------------
RIR2_MYCGE      QDLITKTFTGLTLLDTIQATCQIDHALTDHEQ----VIYANFAFMVGVHARSYGTIFSTL----------
RIR2_MYCPN      QDLITKTFTGLTLLDIQATIGDIKQIDYALTDHEQVIYAN-FAFMVGVHARSYGTIFSTL----------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXQNFDMSSKKDIALTVAVFSAFTEGLQLFASFAILLNFPRHNKMKGMGQIVTWSVRDE
RIR2_IIV3       LKYKAMKDKHEFVFNSRFKSTEEIAVKIALFSAFIEGVQLFSSFIMLLNFTRHGLMKKMGQIIQWSIADE
RIR2_IIV6       LMYEEMKDKQDYIKKFSDSDKEHIAAGIALFSGFTEGMQLFSTFAMLLIFPLNGFMKGMGQIVTWSIVDE
RIR2_CHLTR      QMEITGKVLDPNFRTDSVEGLQEFVKNLVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDE
RIR2_CHLMU      QMEITGKVLDPNFRTDSVEGLQEFIKNLVGYYIIMEGIFFYSGFVMILSFHRQNKMVGIGEQYQYILRDE
RIR2_CHLPN      NERASIRAKDDFQMNFSVQSSEGLGQFIKNLVGYMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDE
RIR2_TREPA      YQWKDDEHLLARNKNEFQDDKSVLALLVAIANYVLEGIYFYSGFMFFYNLGRNNKMPGSVQEIRYINRDE
RIR2_BACHD      FEYWKHDDVLKERNEFIIDGYEKFVLESIVYDVILEGLNFYSGFAFFYNLARNQKMVSTSTMINYINRDE
RIR2_RSIV       SAAEDMPCVKAKAQQWLNATHKPIATRLLAFAA-VEGVMFSGSFAAIFWLKKRSLMPGLAFSNELISRDE
RIR2_ASFP4      EKHPIIKKMAQWVRQWMDPTKNSLGERLVGFAA-VEGILFQNHFVAIQFLKEQNIMPGLVSYNEFISRDE
RIR2_ASFK5      EKHPIIRKMAQWVQQWMDPVKNSLGERLVGFAA-VEGILFQNHFVAIQFLKEQNIMPGLVSYNEFISRDE
RIR2_ASFWA      EKHPIIKKMAQWVRQWMDPTKNSLGERLVGFAA-VEGILFQNHFVAIQFLKEQNIMPGLVSYNEFISRDE
RIR2_ASFM2      EKHPIIKKMAQWVRQWMDPARNSLGERLVGFAA-VEGILFQNHFVAIQFLKEQNIMPGLVSYNEFISRDE
RIR2_ASFB7      EKHPIIKKMAQWVRQWMDPDRNTLGERLVGFAA-VEGILFQNHFVAIQFLKEQNIMPGLVSYNEFISRDE
RIR2_HELPJ      RNDMQLKSKNDYIAQVYMELAKNPTLKALFANQILEGIXXXXXXXXXXTLARSGKMLGSAQMIRFIQRDE
RIR2_HELPY      RNDMQLKSKNDYIAQVYMELAKNPTLKALFANQILEGIXXXXXXXXXXTLARSGKMLGSAQMIRFIQRDE
RIR2B_MOUSE     ETMPYVKKKADWALRWIADRKSTFGERVVAFAA-VEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDE
RIR2_YLDV       ENMNCVKQKANWAKKWIESKNRTYGERLVAFAA-VEGIFFSGSFAAIFWIKKRGLMPGLTFSNELISRDE
RIR2_DICDI      NAIETIPC---------IKKKAEWALRINDSDSFAERLVAFAAVEXXXXXXXXXKKRGLMQGLTFSSRDE
RIR2_TRYBB      LHAIRTIPCIEKKAKWAIGSQTSFPTRLVAFAA-VEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDE
RIR2B_MACFA     ETMPYVKKKADWALRWIADRKSTFGERVVAFAA-VEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDE
RIR2_VACCW      FNAIETMPCVKKKADWAQKWIHDSA-------GYGERLIAFAAVEXXXXXXXXXKKRGLMPGLTFSSRDE
RIR2_VACCA      FNAIETMPCVKKKADWAQKWIHDSA-------GYGERLIAFAAVEXXXXXXXXXKKRGLMPGLTFSSRDE
RIR2_NEUCR      FNAIDTIPCIRKKADWALRWITDKSSTFAVAFAAVEGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDE
RIR2_PLAF4      ENIPAVKNKALWAAKWINDTNSFAERIVA--NACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDE
RIR2_VACCP      FNAIETMPCVKKKADWAQKWIHDSA-------GYGERLIAFAAVEXXXXXXXXXKKRGLMPGLTFSSRDE
RIR2_VACCC      FNAIETMPCVKKKADWAQKWIHDSA-------GYGERLIAFAAVEXXXXXXXXXKKRGLMPGLTFSSRDE
RIR2A_ARATH     ETIPCISKKAKWCLDW-IQSPMSFAVRLVAF-ACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDE
RIR4_ECOLI      AWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDE
RIR2_DANRE      ETMPCVKKKADWALNWIGDKNARYGERVVAFAA-VEXXXXXXXXXXXXWLKKRGLMPGLTFSNELISRDE
RIR2_HUMAN      NAIETMPC---------VKKKADWALRWIGDKEATYGERVVAFAAVEXXXXXXXKKRGLMPGLTFSSRDE
RIR2_ENCCU      RTIPSVKEKADWAIRWIEDKNSDFATRLVAF-ACVEGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDE
RIR2B_ARATH     FRAIETIPCVTKKAEWAMNGSQSFAERIVAF-ACVEXXXXXXXXXXXXWLKKRGLMPGLTFSNELISRDE
RIR2_VARV       FNAIETMPCVKKKADWAQKWIHDSA-------GYGERLIAFAAVEXXXXXXXXXKKRGLMPGLTFSSRDE
RIR2_PLAFG      ENIPAVKNKALWAAKWINDTNSFAERIVA--NACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDE
RIR2_YEAST      HTIPEIGEKAEWALRWIQDADALFGERLVAFASI-EGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDE
RIR2_TOBAC      FRAVETNPCVEKKAKWALDGSETFAERLVAF-ACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDE
RIR2_MOUSE      NAIETMPC---------VKKKADWALRWIGDKEATYGERVVAFAAVEXXXXXXXKKRGLMPGLTFSSRDE
RIR2_MACFA      NAIETMPC---------VEKKADWALRWIGDKEATYGERVVAFAAVEXXXXXXXKKRGLMPGLTFSSRDE
RIR2_MESAU      FNAIETMPC--------VKKKADWALRWIGDKEATYGERVVAFAAVEXXXXXXXKKRGLMPGLTFSSRDE
RIR2_BUCBP      WHLFGEGKHTINGKKIKIDLKKKLYLCLISVNAL-EAIRFYVSFACSFAFAEREKMEGNAKIIRLIARDE
RIR2_MYCLE      RWSEENNNLQRKAKIVMEYYRGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDE
RIR2B_PONAB     ETMPYVKKKADWALRW-IADRKSTXXXXXXXXXXXXXXXXSGSFAAIFWLKKRGLMPGLTFSNELISRDE
RIR2B_HUMAN     ETMPYVKKKADWALRW-IADRKSTXXXXXXXXXXXXXXXXSGSFAAIFWLKKRGLMPGLTFSNELISRDE
RIR2_RAT        FNAIETMPC--------VKKKADWALRWIGDKEATYGERVVAFAAVEXXXXXXXKKRGLMPGLTFSSRDE
RIR4_SALTY      AWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDE
RIR2_EHV4       VVKDVAIDLKVSWLQAKVRECKSVAEKY-ILMILIEGVFFASSFASIAYLRTHNLFVVTCQSNDLISRDE
RIR2C_ARATH     FRAIETIPCVAKKAQWAMDGSQTFAERIIAF-ACVEXXXXXXXXXXXXWLKKRGLMPGLTFSNELISRDE
RIR2_LEIAM      LHAIQTIPCIQKKAEWPIGSSASFQQRLIGFAA-VEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDE
RIR2_EHV1B      YVASIIGDAAIGRKVAWLQAKVRECGSVAILMILIEGLFFASSFASIAYLRTHNLFVVTCQSNDLISRDE
RIR2_DROME      NAIETMPA---------VKRKADWALSWISSKSANFGERIIAFAAVEXXXXXXXKKRGLMPGLTFSSRDE
RIR2_SPISO      ETMPCVKEKADWAMRWINDDSSSYAERVVAFAA-VEXXXXXXXXXXXXWLKKRGIMPGLTFSNELISRDE
RIR2_MYCTU      DWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVMLESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDE
RIR2_BACSU      EWVKQNKYLQKKAQMIAIQKDDEISLFKAVASVYLESFLFYSGFYYPLYFYGQGKLMQSGEIINLILRDE
RIR2_MIMIV      INSIKTMPSIKKKANKWIKSDKTYAHKLVAFS-IVEGVFFSGSFASILKTREMHVMPGLIISNQFIARDE
RIR2_HAEIN      DISSYYDDLIRDSQLYGLSLKKQLYLCLMSVNAL-EAIRFYVSFACSFAFAERRLMEGNAKIIKFIARDE
RIR2_SALTY      VTNEQIQKRAEGISAYEMTSKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
RIR2_ECOLI      WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
RIR2_ECO57      WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
RIR2_CAEEL      DEFEFIKKKADWALRWISDKKASFAERLIAFAA-VEXXXXXXXXXXXXWLKKRGLMPGLTHSNELISRDE
RIR2_BUCAI      DDIISNKNIYDRAQNISIYYDELINLT-SYWHLLGEGIHLYVSFACSFAFAERELMEGNAKIIRLIARDE
RIR2_AQUAE      NYWREDERLLERNKEFIRKPNEENFIKATIGNYILESLYFYSGFAFFYTLGRQGKMRNTVQQIKYINRDE
RIR2_HHV2H      AYVARTINHPAIRVKVDWLEARDSIPEKFILMILIEGVFFAASFAAIAYLRTNNLLRVTCQSNDLISRDE
RIR2_HHV23      AYVARTINHPAIRVKVDWLEARDSIPEKFILMILIEGVFFAASFAAIAYLRTNNLLRVTCQSNDLISRDE
RIR2_BUCAP      LIRITAYWHLLGEGNHKINEKKXXXXXXXISVNVLEAIRFYVSFACSFAFAEREIMEGNAKIIRLIARDE
RIR2_SUHVK      YVRAALRDEAIRRKVEWLDSRVAECASVALLMILIEGXXXXXXXXXXXYLRTHNLFVVTCQSNDFISRDE
RIR2_SWPVK      ETMECVKKKADWARKW-ISSNKVYGERVVAFAA-VEGIFFSGSFAAIFWIKKRGLMPGLTFSNELISRDE
RIR2_SCHPO      LTMGSIKAKAKWALRWINDEDSTYAIRLVAFAA-VEXXXXXXXXXXXXWLKKRGLMPGLTFSNELICRDE
RIR2_OSHV1      VNAYKDPEFAPIKKKVDISVENDSRGEMVVGQVCTEAIMFAASFAILLKF-RAPYMRALVLGNEFIRRDE
RIR4_YEAST      KEIANLPEVKHKAAFIERWISNDDSLYAERLVAFAEGIFQAGNYASMFWLTDKKIMPGLAMANRNICRDR
RIR2_BHV1C      GYVEGALGDPAVRRKVDWLXXXXXXXXXXVLMILIEGIFFSSSFAAIAYLRTHNLFVVTCQTNDLISRDE
RIR2_VZVO       YVNVTINNPSIQQKVQWLEEKVRDNPSVAILMILIEGIFFVSSFAAIAYLRNNGLFVVTCQFNDLISRDE
RIR2_VZVD       YVNVTINNPSIQQKVQWLEEKVRDNPSVAILMILIEGIFFVSSFAAIAYLRNNGLFVVTCQFNDLISRDE
RIR2_MYCGA      EWVINNEKLQARAKFLVPYYTSDDPLKSKIAAALMXXXXXXXXXXXXXXXAARGKLPNTSDIIRLILRDK
RIR2_BPT4       KDQGLILADKDVEQRAKRDLMKSLYLCLHVINAL-EAIRFYVSFACTFNFHKNMEMEGNAKIMKFIARDE
RIR2_HHV1K      -------------------------------------------------------------------RDE
RIR2_HHV11      -------------------------------------------------------------------RDE
RIR2_MYCGE      ----------------------------------------------------------------------
RIR2_MYCPN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFIDLAFEMGPMQGLTAQDVKLYIRFIA
RIR2_IIV3       THHTNSMMELFSTLVVENKSIRLGVLEARVRDTARKIVQLEDGFIDLAFSMGEMRQLTADDVKSYIRYIT
RIR2_IIV6       TQHTEGMIELFKVFVEENQPIRPSVLQETVYKIAKEMVGLEEAFIDLVFKKYKDEGLTPQRLKAYIKYIA
RIR2_CHLTR      TIHLNFGIDLINGIKEENPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRG-ILGLRASMFIDYVQHIA
RIR2_CHLMU      TIHLNFGVDLINGIKEENPEIWTTELQQEIIEMIQRAVDLE---IDYARDCLPILGLRASMFIDYVQHIA
RIR2_CHLPN      TIHLNFGIDLINGIKEENPEVWTTELQEEIVALIEKAVELEIEYAKDCLPRG-ILGLRSSMFIDYVRHIA
RIR2_TREPA      NTHLWLFRSIIQELQKEEPQVFTARFRDMIREGCEQEIKWGDYVIG-----DQIPGLNRHMVADYIRYLG
RIR2_BACHD      QLHVYLFTNIFKELLVEFPELNTEEVKTTLMKAADL---EKDWFRYIIGDKIP--GINPEDMETYISFIA
RIR2_RSIV       GLHCDFACMLFRQMANK-------PCQDDAHQIISDAVDIETAFFREALKT-PLLGMNSDSMKLYIQFVA
RIR2_ASFP4      GVHCSFACFLISNYVYNIPE------ERIIHKILKEAVELVDEFINYAFDRGRVPGFSKEMLFQYIRYFT
RIR2_ASFK5      GMHCSFACFLISNYLNNIPE------EKIIHKILKEAVELVDEFISYAFDRGSVPGFSKEMLFQYIRYFT
RIR2_ASFWA      GVHCSFACFLISNYVYNIPE------EKIIHKILKEAVELVDEFISYAFDRGRVPGFSKEMLFQYIRYFT
RIR2_ASFM2      GMHCSFACFLISNYVYNIPE------EKIIHKILKEAVELVDEFINYAFDRGRVPGFSKEMLFQYIRYFT
RIR2_ASFB7      GVHCSFACFLISNYVYNIPE------EKIIHKILKEAVELVDEFINYAFDRGRVPGFSKEMLFQYIRYFT
RIR2_HELPJ      VTHLILFQNMINALRNERADLFTPQLINEVIEMFKKAVEIEASWGDYITQ-GKILGLTSSLIEQYIQFLA
RIR2_HELPY      VTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIEALWGDYITQ-GKILGLTSSLIEQYIQFLA
RIR2B_MOUSE     GLHCDFACLMFQYLVNKPSEDRVREIIAD-------AVQIEQEFLTEALPVG-LIGMNCVLMKQYIEFVA
RIR2_YLDV       GLHCDFACIMFKHLLN-------PPLNSVVRDIIIEAVNIEKNFLTEAIPV-KLIGMNCDLMKQYIEFVA
RIR2_DICDI      GLHCDFACLLYTKLQRKDPKV--------IEKMIRDAVECEKEFICESLPV-DLIGMNSRSMSQYIEFCA
RIR2_TRYBB      GLHTDFACLLYEKYINKLPRDRVLEI------ICNAVIERE--FICDALPV-RLIGMNSQLMTQYIEFVA
RIR2B_MACFA     GLHCDFACLMFQYLVNKPSEERVREIIVD-------AVQIEQEFLTEALPVG-LIGMNCILMKQYIEFVA
RIR2_VACCW      GLHCDFACLMFKHLLH-------PPSEETVRSIITDAVSIEQEFLTAALPV-KLIGMNCEMMKTYIEFVA
RIR2_VACCA      GLHCDFACLMFKHLLH-------PPSEETVRSIITDAVSIEQEFLTAALPV-KLIGMNCEMMKTYIEFVA
RIR2_NEUCR      GLHTDFACLLFSH-LNNRPS------KQLIQEIIVDAVRIEQEFLTEALPCA-LLGMNADLMKQYIEFVA
RIR2_PLAF4      GLHTDFNCLIYSLLDNKLPEQIIQNIVKEAVEVERSFI-CESLPCDLI-------GMNSRLMSQYIEFVA
RIR2_VACCP      GLHCDFACLMFKHLLH-------PPSEETVRSIITDAVSIEQEFLTAALPV-KLIGMNCEMMKTYIEFVA
RIR2_VACCC      GLHCDFACLMFKHLLY-------PPSEETVRSIITDAVSIEQEFLTAALPV-KLIGMNCEMMKTYIEFVA
RIR2A_ARATH     GLHCDFA-------CXXXXXXXXXXXXEKVYQIVHEAVEIETEFVCKALPC-DLIGMNSNLMSQYIQFVA
RIR4_ECOLI      AVHGYYIGYKYQKNMEKISLGQREELKSFAFDLLLELYDNELQYTDELYAETPW----ADDVKAFLCYNA
RIR2_DANRE      GLHCDFACLMFKHLINKPSE-------ETVKKIIMNAVEIEQEFLTDALPV-KLIGMNCDLMKQYIEFVA
RIR2_HUMAN      GLHCDFACLMFKHLVHKPSEERVREI---IINAVRI----EQEFLTEALPV-KLIGMNCTLMKQYIEFVA
RIR2_ENCCU      GLHCE-----FACLLHYHLKKKCNRIKEVVMDA----VEIEKKFLSESLPVN-LIGMNCNLMCRYIEFVA
RIR2B_ARATH     GLHCDFACLIYSLL---RTKLDEDRLKAIVCDA----VEIEREFVCDALPCA-LVGMNRELMSQYIEFVA
RIR2_VARV       GLHCDFACLMFKHLLY-------PPSEETVRSIITDAVSIEQEFLTVALPV-KLIGMNCEMMKTYMEFVA
RIR2_PLAFG      GLHTDFNCLIYSLLDNKLPEQMVQNIVKEAGG-----VEVEKSFICESLPCD-LIGMNSRLMSQYIEFVA
RIR2_YEAST      GLHTDFACLLFAH-LKNKPD------PAIVEKIVTEAVEIEQRYFLDALPVA-LLGMNADLMNQYVEFVA
RIR2_TOBAC      GLHCDFACLLY--------SLLRTKLTEERVKGVADAVEIEREFVCDALPCA-LVGMNGDLMSKYIEFVA
RIR2_MOUSE      GLHCDFACLMFKHLVHKPAEQRVREI-------ITNAVRIEQEFLTEALPV-KLIGMNCTLMKQYIEFVA
RIR2_MACFA      GLHCDFACLMFKHLVHKPSEERVREI---IINAVRV----EQEFLTEALPV-KLIGMNCTLMKQYIEFVA
RIR2_MESAU      GLHCDFACLMFKHLVHKPSEQRVQEI-------ITNAVRIEQEFLTEALPV-KLIGMNCTLMKQYIEFVA
RIR2_BUCBP      ALHLTSTQHILNILHNDKNNEGMSDISKECYEECYHLFDQEKIWAKYLFQNGSMLGLNQEILSQYIEYIT
RIR2_MYCLE      AVHGYYIGYKFQRGLVLVDDARRAELKEYTYELLFELYDNE---VEYTQDLYDRVGLT-EDVKKFLRYNA
RIR2B_PONAB     GLHCDFACLMFQYLVNKPSEERVREIIVDAVKI-------EQEFLTEALPVG-LIGMNCILMKQYIEFVA
RIR2B_HUMAN     GLHCDFACLMFQYLVNKPSEERVREIIVDAVKI-------EQEFLTEALPVG-LIGMNCILMKQYIEFVA
RIR2_RAT        GLHCDFACLMFKHLVHKPSEQRVKEI-------ITNSVRIEQEFLTEALPV-KLIGMNCTLMKQYIEFVA
RIR4_SALTY      AVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEALYETG-----WVNDVKAFLCYNA
RIR2_EHV4       AIHTNASCCIYNNYLFEKPA------PTRIYALFSEAVNIECEFL-LSHAPKSSHLLDIEAIICYVRYSA
RIR2C_ARATH     GLHCDFACLLY--------TLLKTKLSEERVKSVCDAVEIEREFVCDALPCA-LVGMNRDLMSQYIEFVA
RIR2_LEIAM      GLHTDFACLLYNSHIHKLPRERVLEIIVD-------AVNIEREFICDALPV-RLIGMNAELMAQYIEFVA
RIR2_EHV1B      AIHTRASCCIYNNYLFEKPE---PKRIYELFSECEFLLSHAPQYSHL---------LDIGAIISYVRYSA
RIR2_DROME      GLHCDFAVLMFQHLVQRPKXXXXXXXXXD-------AVAIEQEFLTDALPVN-LIGMNCDLMSQYIEFVA
RIR2_SPISO      GLHCDFACLMFSHLVNKPSQ-------ERIHQIIDEAVKIEQVFLTEALPC-RLIGMNCDLMRQYIEFVA
RIR2_MYCTU      AVHCQRGLADLTDAERADHREYTCELLHTLY------ANEIDYAHDLYDELG-----WTDDVLPYMRYNA
RIR2_BACSU      AIHGVYVGLLAQEIYNKQTE----EKKAELREAIDXXXXXXXXXXXXXXDLYDQVGLS-HDVKKFIRYNA
RIR2_MIMIV      NKHVELACIMYSLLNNRLKE-------SVVYQXXXXXXXXXXXXXNDSLPC-KLLGMNSELMSQYIKYVA
RIR2_HAEIN      ALHLTGTQHILNIMAQDDPEMAAEECKQEAYDLFVAAAEQEKAWADYLFKDGSMIGLNRDILVQYVEYIT
RIR2_SALTY      ALHLTGMLNLLRSGV-DDPEMAAEECKQECYDLFVQAAQQEKEWADYLFRDGSMIGLNKDILCQYVEYIT
RIR2_ECOLI      ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
RIR2_ECO57      ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
RIR2_CAEEL      GLHRDFACLLYS-------KLQKKLTQQRIYDIIKDAVAIEQEFLTEALPV-DMIGMNCRLMSQYIEFVA
RIR2_BUCAI      ALHLTGTQHILNLLSNENMEDVVLECKEEAINIFISAAQQEKKWASYLFKSGSMLGLNKDILCQYIEYIT
RIR2_AQUAE      ----NCHVTLFRNIINENPELFTPEIEKWIVEYFKYAVNEEIKWGQYVTQ-NQILGINDVLIERYIKYLG
RIR2_HHV2H      AVHTTASCYIYNNYLHAKPEA------ARVYRLFREAVDIEIGFIQAPTDSSILSPGALAAIENYVRFSA
RIR2_HHV23      AVHTTASCYIYNNYLHAKPEA------ARVYRLFREAVDIEIGFIQAPTDSSILSPGALAAIENYVRFSA
RIR2_BUCAP      ALHLTGTQHXXXXXXXXXXXXXXXECREEAIKIFISASEQEKKWAKYLFQDGSMLGLNKDILCQYIEYIT
RIR2_SUHVK      AIHTSASCCIYNNYLGDAPR---PD-EARIHQLFAEAVEIECEFLRARAPRDSLL-LDLPAIISYVRYSA
RIR2_SWPVK      GLHCDFACLMFKHLLH-------PPSKEVITSIIIDAVNIEKEFLTVAIPV-DLIGMNCCLMSQYIEFVA
RIR2_SCHPO      GLHTDFACLMFSHLKHR------PGRXXXXXXXXXXXXXXXXYFTD-ALPVS-LLGMNKDLMCQYIEFVA
RIR2_OSHV1      TLH----FRFYAELLRLMPDRPSDERXXXXXXXXXXXXXXXXXYV----VPEGVKYITKDRLIQHVKANT
RIR4_YEAST      GAYTDFSCLLFAHLTKPNPKI--------IEKIITEAVEIEKEYYSNSLPVEKF-GMDLKSIHTYIEFVA
RIR2_BHV1C      AVHTAASCCIFDNYLERPPPARIYELFREAWKLSASL-----------FGCAPRGSLDVEAISAYVEYSA
RIR2_VZVO       AIHTSASCCIYNNYVPEKPAI------TRIHQLFSEAVEIECAFLK---SHAPKTRLVNVDITQYVKFSA
RIR2_VZVD       AIHTSASCCIYNNYVPEKPAI------TRIHQLFSEAVEIECAFLK---SHAPKTRLVNVDITQYVKFSA
RIR2_MYCGA      VIHNYYSGYKYRLKVQKLPKEKQEEYKKFVFEILYKLIELEKDFLR---ELYDGFGL-ADEAIAFSLYNA
RIR2_BPT4       QLHLKGTQYIIRQLSGTDGDEWAQECEQEAVDIFMEVNRQEKDWAVHLFKDGDVPGLNTNSMWSFIDYLT
RIR2_HHV1K      AVHTTASCYIYNNYLHAKPP---PD---RVYGLFRQAVEIEIGFIQAPTDSHILSPAALAAIENYVRFSA
RIR2_HHV11      AVHTTASCYIYNNYLHAKPP---PD---RVYGLFRQAVEIEIGFIQAPTDSHILSPAALAAIENYVRFSA
RIR2_MYCGE      ----------------------------------------------------------------------
RIR2_MYCPN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NRRLSQLGLEPIYDVDKNPLTWLDSMLNAVEHMNFFEGRSTEYSKAATQGTWTEAFS
RIR2_IIV3       NRRLQTMGYLPLYSVVENPLPWVEDLLNAPSHTNFFENKPTEYAKASLTGDW-----
RIR2_IIV6       DRRLNLMGYKSIFNLETNPLPELEIMINAPTHTNFFENRSTDYANVSTKGTWSEIWN
RIR2_CHLTR      DRRLERIGLKPIYHT-KNPFPWMSETIDLNKEKNFFETRVIEYQHAASL-TW-----
RIR2_CHLMU      DRRLERIGLKPIYHT-KNPFPWMSETIDLNKEKNFFETRVTEYQHAASL-TW-----
RIR2_CHLPN      DRRLERIGLKPIYH-SRNPFPWMSETMDLNKEKNFFETRVTEYQTA-----------
RIR2_TREPA      NLRCENLGFEPLYEVEPESMSWVSQYSNALIKTDFFEAKSTAYAKSS----------
RIR2_BACHD      NKRAVQLGMEPYPEIKHNPMKW----IRAYEDVNFFEQKSRQYAKVSADNGFDE---
RIR2_RSIV       DRLLDALGYAKMYNV-SNPFDFMDN-ISIEGKTNFFERRVSEYQR------------
RIR2_ASFP4      DNLCFMMQCKSIYKVG-NPFPQMTKFLNEVEKTNFFELRPTQY--------------
RIR2_ASFK5      DNLCFMLQCKSIYKVE-NPFPQMTKFLNEVEKTNFFELRPTQY--------------
RIR2_ASFWA      DNLCFMMQCKSIYKVG-NPFPQMTKFLNEVEKTNFFELRPTQY--------------
RIR2_ASFM2      DNLCFMMQCKSIYNVG-NPFPQMTKFLNEVEKTNFFELRPTQY--------------
RIR2_ASFB7      DNLCFMMQCKSIYKVG-NPFPQMTKFLNEVEKTNFFELRPTQY--------------
RIR2_HELPJ      DSRLSKVGIAKVYGV-QHPIKWVESFSSFNERSNFFEARVSNYAKGS----------
RIR2_HELPY      DSRLSKVGIAKVYGV-QHPIKWVESFSSFNERSNFFEARVSNYAKGS----------
RIR2B_MOUSE     DRLLGELGFSKIFQAE-NPFDFMEN-ISLEGKTNFFEKRVSEYQRFAVMAETTD---
RIR2_YLDV       DRLLLELGCDKYY-CSKNPFDFMEN-ISLEGKTNFFEKRVSEYQK------------
RIR2_DICDI      DRLVVSLGYKKIFN-SSNPFEWME-MISLQRKSNFFEGKVAEYAKVAIQG-------
RIR2_TRYBB      DRLLVSLGYDRHYN-SKNPFDFMD-MISLQGKTNFFEKKVGEYQKAGVMSS------
RIR2B_MACFA     DRLLVELGFSKIFQAE-NPFDFMEN-ISLEGKTNFFEKRVSEYQRFAVMAETTD---
RIR2_VACCW      DRLISELGFKKIYNV-TNPFDFMEN-ISLEGKTNFFEKRVGEYQKMGVMSQEDNHFS
RIR2_VACCA      DRLISELGFKKIYNV-TNPFDFMEN-ISLEGKTNFFEKRVGEYQKMGVMSQEDNHFS
RIR2_NEUCR      DRLLVALGNEKIYR-STNPFDFMEN-ISLGGKTNFFEKRVGDYQKAGVMNSTKKA--
RIR2_PLAF4      DRLLECLGCSKIFH-SKNPFNWMD-LISLQGKTNFFEKRVADYQKS-----------
RIR2_VACCP      DRLISELGFKKIYNV-TNPFDFMEN-ISLEGKTNFFEKRVGEYQKMGVMSQKDNHFS
RIR2_VACCC      DRLISELGFKKIYNV-TNPFDFMEN-ISLEGKTNFFEKRVGEYQKMGVMSQEDNHFS
RIR2A_ARATH     DRLLVTLGCERTYKAE-NPFDWME-FISLQGKTNFFEKRVGEYQKAS----------
RIR4_ECOLI      NKALMNLGYEPLFPAEMNPAILAALSPNADENHDFFSGSGSSY--------------
RIR2_DANRE      DRLLLELGFDKVYRVE-NPFDFMEN-ISLEGKTNFFEKRVGEYQRMGVMSGTTD---
RIR2_HUMAN      DRLMLELGFSKVFRVE-NPFDFMEN-ISLEGKTNFFEKRVGEYQRMGVMSSPTE---
RIR2_ENCCU      DRLLENLGEERVYNA-TNPFDFMEN-ISLVGKTNFFDKRESQYQKA-----------
RIR2B_ARATH     DRLLAALGCAKVYGV-SNPFDWME-LISLQGKTNFFEKRVGEYQKAS----------
RIR2_VARV       DRLISELGFKRIYNV-TNPSDFMEN-ISLEGKTNFFEKRVGEYQKMGVMSQEDNHFS
RIR2_PLAFG      DRLLECLGCSKIFH-SKNPFNWMD-LISLQGKTNFFEKRVADYQKS-----------
RIR2_YEAST      DRLLVAFGNKKYYKVE-NPFDFMEN-ISLAGKTNFFEKRVSDYQKAGVMSKSTK---
RIR2_TOBAC      DRLLDALGYDKLYNA-QNPFDWME-LISLQGKTNFFEKRVGEYQKASVMSS------
RIR2_MOUSE      DRLMLELGFNKIFRVE-NPFDFMEN-ISLEGKTNFFEKRVGEYQRMGVMSNSTE---
RIR2_MACFA      DRLMLELGFSKVFRVE-NPFDFMEN-ISLEGKTNFFEKRVGEYQRMGVMSSPTE---
RIR2_MESAU      DRLMLELGFNKIFKVE-NPFDFMEN-ISLEGKTNFFEKRVGEYQR------------
RIR2_BUCBP      NIRMKAIGLPSPFKILSNPIPWINSWL------------------------------
RIR2_MYCLE      NKALMNLGYEALFETDVNPAILSALSPNADENHDFFSGSGSSY--------------
RIR2B_PONAB     DRLLVELGFSKVFQAE-NPFDFMEN-ISLEGKTNFFEKRVSEYQRFAVMAETTD---
RIR2B_HUMAN     DRLLVELGFSKVFQAE-NPFDFMEN-ISLEGKTNFFEKRVSEYQRFAVMAETTD---
RIR2_RAT        DRLMLELGFNKIFKVE-NPFDFMEN-ISLEGKTNFFEKRVGEYQRMGVMSNSTE---
RIR4_SALTY      NKALMNLGYEALFPADVNPAILAALSPNADENHDFFSGSGSSYVMGKTVETEDE---
RIR2_EHV4       DRLLGEIGLSPLFNAPKPPPSFPLAFMTVEKHTNFFERRSTAYS-------------
RIR2C_ARATH     DRLLGALGYGKVYGV-TNPFDWME-LISLQGKTNFFEKRVGDYQKASVMSS------
RIR2_LEIAM      DRLLVSLGEEKHYR-STQPFDFME-MISLQGKTNFFEKRVGEYQKAGVMST------
RIR2_EHV1B      DRLLGEIGLSPLFNAPKPSPSFPLAFMTVEKHTNFFERRSTAYS-------------
RIR2_DROME      DRLLVELGVGKIYNT-KNPFNFME-MISLDGKTNFFEKKVGEYQR------------
RIR2_SPISO      DRLLLELKCDKLYN-KENPFDFMEH-ISLEGKTNFFEKRVGEYQK------------
RIR2_MYCTU      NKALANLGYQPAFDRDTNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPT------
RIR2_BACSU      NKALMNLGFDPYFEEDINPIV-LNGLNTKTKSHDFFSMKGNGYKKATVE--------
RIR2_MIMIV      DRLLVDLGYRKKFNVD-NPFEYM-KKIDVFVKANFFEKRNDAYSNA-----------
RIR2_HAEIN      NIRMQAVGLPLPFQTRSNPIPWINAWL------------------------------
RIR2_SALTY      NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
RIR2_ECOLI      NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
RIR2_ECO57      NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
RIR2_CAEEL      DHLLVELGCDKLYK-SKNPFDFMEN-ISIDGKTNFFEKRVSEYQR------------
RIR2_BUCAI      NIRMHAIGFKMPFKKQSNPIPWINDWLTS----------------------------
RIR2_AQUAE      NLRITQIGFDPIYEVTENPLKWIDEFINNTK-TDFFQAKPQTYSKA-----------
RIR2_HHV2H      DRLLGLIHMQPLYSAPAPDASFPLSLMSTDKHTNFFECRSTSYAGA-----------
RIR2_HHV23      DRLLGLIHMQPLYSAPAPDASFPLSLMSTDKHTNFFECRSTSYAGA-----------
RIR2_BUCAP      NIRMHAIGFKMPFEKTSNPIPWINSWLNS----------------------------
RIR2_SUHVK      DRLLQAIGASPLFGAPAPAADFPMALMVAEKHTNFFERRSTNYT-------------
RIR2_SWPVK      DRLLTELGCE-----------------------------------------------
RIR2_SCHPO      DRLLVALGNDKYYNV-TNPFDFMEN-ISLAGKTNFFEKKVSDYQIA-----------
RIR2_OSHV1      NQVCEMLDINPIYNVLLSPLLYMNT-LESEQKINFFEGKATEYN-------------
RIR4_YEAST      DGLLQGFGNEKYYNA-VNPFEFMEDVATAGK-TTFFEKKVSDYQKAS----------
RIR2_BHV1C      DRLLAAIQXXXXXXXXXXXXXXXLALMTAEKHTNFFERRSTNYT-------------
RIR2_VZVO       DRLLSAINVPKLFNTPPPDSDFPLAFMIADKNTNFFERHSTSYA-------------
RIR2_VZVD       DRLLSAINVPKLFNTPPPDSDFPLAFMIADKNTNFFERHSTSYA-------------
RIR2_MYCGA      GKFLQNCGYESPFTPEESPEVFAQLSARADENHDFFSGNGSSYIMGVTEET------
RIR2_BPT4       VSRMKQCGLPPITDAPKHPYPWIREYLNS----------------------------
RIR2_HHV1K      DRLLGLIHMKPLFSAPPPDASFPLSLMSTDKHTNFFECRSTSYAGA-----------
RIR2_HHV11      DRLLGLIHMKPLFSAPPPDASFPLSLMSTDKHTNFFECRSTSYAGA-----------
RIR2_MYCGE      ---------------------------------------------------------
RIR2_MYCPN      ---------------------------------------------------------