[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ22048.1

[Show Plain Result]


## Summary of Sequence Search
    1::333
    2::324     1e-61  38%  324 aa  YHDH_ECOLI RecName: Full=Putative quinone oxidoreductase yhdH;     
    1::330     2e-54  39%  330 aa  YHFP_BACSU RecName: Full=Putative quinone oxidoreductase yhfP;     
  119::348     7e-18  31%  348 aa  ADH2_KLULA RecName: Full=Alcohol dehydrogenase 2;       
    2::338     1e-16  28%  339 aa  ADH2_BACST RecName: Full=Alcohol dehydrogenase;         Short=ADH; 
   30::348     4e-16  28%  348 aa  ADH1_KLUMA RecName: Full=Alcohol dehydrogenase 1;       
  113::395     6e-16  31%  396 aa  RT4I1_MOUSE RecName: Full=Reticulon-4-interacting protein 1,
   34::272     6e-16  30%  329 aa  QOR_CAVPO RecName: Full=Quinone oxidoreductase;       
   34::255     2e-14  29%  329 aa  QOR_HUMAN RecName: Full=Quinone oxidoreductase;       
   34::272     3e-14  29%  329 aa  QOR_PIG RecName: Full=Quinone oxidoreductase;       
  113::279     1e-13  34%  396 aa  RT4I1_BOVIN RecName: Full=Reticulon-4-interacting protein 1,
   34::255     1e-13  29%  329 aa  QOR_PONAB RecName: Full=Quinone oxidoreductase;       
   45::344     2e-13  31%  347 aa  YBI2_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
  113::279     2e-13  36%  396 aa  RT4I1_HUMAN RecName: Full=Reticulon-4-interacting protein 1,
   34::204     2e-13  33%  330 aa  QOR_BOVIN RecName: Full=Zeta-crystallin;
  119::353     3e-13  30%  353 aa  ADH1_NEUCR RecName: Full=Alcohol dehydrogenase 1;       
   23::351     5e-13  26%  351 aa  ADH5_YEAST RecName: Full=Alcohol dehydrogenase 5;       
   23::351     5e-13  26%  351 aa  ADH5_SACPS RecName: Full=Alcohol dehydrogenase 5;       
  100::381     7e-13  28%  387 aa  RT4I1_DANRE RecName: Full=Reticulon-4-interacting protein 1
   38::236     7e-13  34%  331 aa  QOR_MOUSE RecName: Full=Quinone oxidoreductase;       
   29::234     2e-12  27%  335 aa  ZDH1_STAAW RecName: Full=Zinc-type alcohol dehydrogenase-like
   29::234     2e-12  27%  335 aa  ZDH1_STAAS RecName: Full=Zinc-type alcohol dehydrogenase-like
   29::234     2e-12  28%  335 aa  ZDH1_STAAN RecName: Full=Zinc-type alcohol dehydrogenase-like
   29::234     2e-12  28%  335 aa  ZDH1_STAAM RecName: Full=Zinc-type alcohol dehydrogenase-like
   38::272     3e-12  29%  330 aa  QOR_LAMGU RecName: Full=Quinone oxidoreductase;       
   29::234     9e-12  28%  335 aa  ZDH1_STAAR RecName: Full=Zinc-type alcohol dehydrogenase-like
   29::204     1e-11  29%  333 aa  ZDH1_STAAC RecName: Full=Zinc-type alcohol dehydrogenase-like
   37::332     4e-11  27%  334 aa  QOR_YEAST RecName: Full=Probable quinone oxidoreductase;       
  118::336     4e-11  26%  339 aa  ADH3_BACST RecName: Full=Alcohol dehydrogenase;       
 1827::1994    5e-11  35% 2552 aa  PKS40_DICDI RecName: Full=Probable polyketide synthase 40;       
  118::337     6e-11  27%  337 aa  ADH1_BACST RecName: Full=Alcohol dehydrogenase;       
   38::208     8e-11  35%  329 aa  QOR_RAT RecName: Full=Quinone oxidoreductase;       
   54::206     3e-10  29%  336 aa  ZDH1_STAES RecName: Full=Zinc-type alcohol dehydrogenase-like
   54::206     4e-10  29%  336 aa  ZDH1_STAEQ RecName: Full=Zinc-type alcohol dehydrogenase-like
   32::205     4e-10  31%  329 aa  QORH_SPIOL RecName: Full=Quinone-oxidoreductase homolog,
 1823::1990    9e-10  33% 2542 aa  PKS41_DICDI RecName: Full=Probable polyketide synthase 41;       
  129::350     2e-09  25%  355 aa  CADH1_ARATH RecName: Full=Probable cinnamyl alcohol dehydrogenase
   23::245     4e-09  29%  329 aa  PTGR1_CAVPO RecName: Full=Prostaglandin reductase 1;       
  188::348     4e-09  29%  348 aa  ADH2_KLUMA RecName: Full=Alcohol dehydrogenase 2;       
   22::334     6e-09  27%  336 aa  ADH_STAAN RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   22::334     6e-09  27%  336 aa  ADH_STAAM RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   35::273     7e-09  30%  365 aa  YMN1_YEAST RecName: Full=Uncharacterized membrane protein YML131W;
  119::348     7e-09  26%  348 aa  ADH1_PICST RecName: Full=Alcohol dehydrogenase 1;       
    2::322     1e-08  26%  329 aa  YOGA_BACSU RecName: Full=Uncharacterized zinc-type alcohol
   28::328     1e-08  25%  346 aa  YGD6_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
 1913::2081    2e-08  36% 3097 aa  PKS45_DICDI RecName: Full=Probable polyketide synthase 45;       
   23::245     2e-08  29%  329 aa  PTGR1_MOUSE RecName: Full=Prostaglandin reductase 1;       
   22::334     2e-08  26%  336 aa  ADH_STAAW RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   22::334     2e-08  26%  336 aa  ADH_STAAS RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   22::334     2e-08  26%  336 aa  ADH_STAAR RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   22::334     2e-08  26%  336 aa  ADH_STAAC RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   22::334     2e-08  26%  336 aa  ADH_STAAB RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   22::334     2e-08  26%  336 aa  ADH_STAA8 RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   22::334     2e-08  26%  336 aa  ADH_STAA3 RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  188::348     2e-08  30%  348 aa  ADH2_YEAST RecName: Full=Alcohol dehydrogenase 2;       
   23::327     3e-08  30%  329 aa  PTGR1_BOVIN RecName: Full=Prostaglandin reductase 1;       
   61::311     3e-08  28%  377 aa  MECR_DANRE RecName: Full=Trans-2-enoyl-CoA reductase,
  190::350     3e-08  29%  350 aa  ADH1_KLULA RecName: Full=Alcohol dehydrogenase 1;       
   23::324     4e-08  27%  349 aa  PTGR1_RABIT RecName: Full=Prostaglandin reductase 1;       
  130::348     4e-08  25%  375 aa  CADH3_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 3;        
  126::347     4e-08  25%  349 aa  ADHA_BACSU RecName: Full=Probable formaldehyde dehydrogenase adhA; 
   32::328     5e-08  26%  329 aa  QORH_ARATH RecName: Full=Putative quinone-oxidoreductase homolog,
  131::349     1e-07  25%  376 aa  CADH2_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 2;        
   22::348     1e-07  24%  349 aa  ADH1_CAEEL RecName: Full=Alcohol dehydrogenase 1;       
  103::320     1e-07  31%  386 aa  QORL_ARATH RecName: Full=Quinone oxidoreductase-like protein
    6::257     2e-07  27%  340 aa  QOR_LEIAM RecName: Full=Probable quinone oxidoreductase;       
 1893::2061    2e-07  35% 3078 aa  PKS44_DICDI RecName: Full=Probable polyketide synthase 44;       
  195::348     2e-07  29%  348 aa  ADH2_PICST RecName: Full=Alcohol dehydrogenase 2;       
  188::348     2e-07  30%  348 aa  ADH1_YEAST RecName: Full=Alcohol dehydrogenase 1;       
   53::287     3e-07  25%  350 aa  QORL2_RAT RecName: Full=Quinone oxidoreductase-like protein 2;     
   53::287     3e-07  25%  350 aa  QORL2_MOUSE RecName: Full=Quinone oxidoreductase-like protein 2;   
   52::286     3e-07  27%  349 aa  QORL2_BOVIN RecName: Full=Quinone oxidoreductase-like protein 2;   
 1789::1978    3e-07  29% 2531 aa  PKS26_DICDI RecName: Full=Probable polyketide synthase 26;       
   36::349     3e-07  26%  354 aa  CADH4_ORYSJ RecName: Full=Putative cinnamyl alcohol dehydrogenase
   23::327     4e-07  30%  329 aa  PTGR1_PIG RecName: Full=Prostaglandin reductase 1;       
   84::260     5e-07  31%  343 aa  P2_ARATH RecName: Full=Probable NADP-dependent oxidoreductase P2;  
  145::371     5e-07  25%  374 aa  ADH3_KLULA RecName: Full=Alcohol dehydrogenase 3, mitochondrial;   
   23::245     7e-07  27%  329 aa  PTGR1_RAT RecName: Full=Prostaglandin reductase 1;       
 1681::1876    7e-07  31% 2837 aa  PKS3_DICDI RecName: Full=Probable polyketide synthase 3;       
   36::283     9e-07  26%  377 aa  ZADH2_BOVIN RecName: Full=Zinc-binding alcohol dehydrogenase
   23::327     9e-07  25%  329 aa  PTGR1_HUMAN RecName: Full=Prostaglandin reductase 1;       
  188::348     9e-07  27%  348 aa  ADH2_CANAL RecName: Full=Alcohol dehydrogenase 2;       
   77::242     2e-06  30%  325 aa  QOR_PSEAE RecName: Full=Quinone oxidoreductase;       
   86::262     2e-06  28%  345 aa  P1_ARATH RecName: Full=Probable NADP-dependent oxidoreductase P1;  
    2::341     3e-06  26%  344 aa  ADH_SULAC RecName: Full=NAD-dependent alcohol dehydrogenase;       
  107::350     3e-06  24%  350 aa  ADH_SCHPO RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
 1836::2014    3e-06  30% 3010 aa  PKS2_DICDI RecName: Full=Probable polyketide synthase 2;       
 1447::1743    3e-06  23% 2111 aa  MCAS_MYCBO RecName: Full=Mycocerosic acid synthase;       
   55::242     5e-06  32%  327 aa  QOR_SALTY RecName: Full=Quinone oxidoreductase;       
  195::348     5e-06  29%  350 aa  ADH1_EMENI RecName: Full=Alcohol dehydrogenase 1;       
   70::242     1e-05  31%  327 aa  QOR_ECOLI RecName: Full=Quinone oxidoreductase;       
   36::283     2e-05  30%  377 aa  ZADH2_HUMAN RecName: Full=Zinc-binding alcohol dehydrogenase
  133::367     2e-05  26%  367 aa  ADH2_EMENI RecName: Full=Alcohol dehydrogenase 2;       
    2::333     2e-05  26%  337 aa  ADH1_ZYMMO RecName: Full=Alcohol dehydrogenase 1;       
  174::369     4e-05  25%  377 aa  ZADH2_MOUSE RecName: Full=Zinc-binding alcohol dehydrogenase
   47::375     4e-05  24%  375 aa  ADH4_KLULA RecName: Full=Alcohol dehydrogenase 4, mitochondrial;   
   23::349     4e-05  24%  351 aa  ADH2_CAEEL RecName: Full=Alcohol dehydrogenase 2;       
   93::288     5e-05  30%  484 aa  VAT1_DANRE RecName: Full=Synaptic vesicle membrane protein VAT-1
  195::348     5e-05  29%  350 aa  ADH1_ASPFN RecName: Full=Alcohol dehydrogenase 1;       
   24::139     7e-05  26%  325 aa  YBJB_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
 1865::2009    7e-05  35% 2603 aa  PKS16_DICDI RecName: Full=Probable polyketide synthase 16;       
 1659::1816    1e-04  27% 2513 aa  FAS_BOVIN RecName: Full=Fatty acid synthase;       
  127::332     2e-04  25%  376 aa  ETR1_YARLI RecName: Full=Probable trans-2-enoyl-CoA reductase,
   17::219     2e-04  26%  332 aa  QORX_HUMAN RecName: Full=Quinone oxidoreductase PIG3;       
    1::48      2e-04  42%  347 aa  DFRA_PYRCO RecName: Full=Bifunctional dihydroflavonol
    1::48      2e-04  42%  348 aa  DFRA_MALDO RecName: Full=Bifunctional dihydroflavonol
  258::375     3e-04  28%  375 aa  ADH3_YEAST RecName: Full=Alcohol dehydrogenase 3, mitochondrial;   
   80::259     4e-04  26%  351 aa  PTGR2_MOUSE RecName: Full=Prostaglandin reductase 2;       
 1614::1851    4e-04  23% 2504 aa  FAS_MOUSE RecName: Full=Fatty acid synthase;       
 1560::1752    4e-04  29% 2511 aa  FAS_HUMAN RecName: Full=Fatty acid synthase;       
   10::188     6e-04  29%  348 aa  QORL1_MOUSE RecName: Full=Quinone oxidoreductase-like protein 1;   
 1866::2010    6e-04  32% 2604 aa  PKS17_DICDI RecName: Full=Probable polyketide synthase 17;       
 1670::1714    6e-04  40% 2512 aa  FAS_CHICK RecName: Full=Fatty acid synthase;       
   22::107     6e-04  32%  316 aa  DHRS7_DICDI RecName: Full=Dehydrogenase/reductase SDR family
    8::68      6e-04  49%  354 aa  DFRA_HORVU RecName: Full=Dihydroflavonol-4-reductase;       
    3::71      7e-04  37%  295 aa  YGI2_SCHPO RecName: Full=Uncharacterized protein C2A9.02;
    7::68      0.001  34%  269 aa  YBBO_ECOLI RecName: Full=Uncharacterized oxidoreductase ybbO;      
    7::68      0.001  34%  269 aa  YBBO_ECOL6 RecName: Full=Uncharacterized oxidoreductase ybbO;      
 1736::2024    0.001  25% 2968 aa  PKS37_DICDI RecName: Full=Probable polyketide synthase 37;       
    1::333

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSDNFKALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFA
YHDH_ECOLI      -----QALLLEQQDGKTLASVQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFA
YHFP_BACSU      MSTLFQALQAEKNADDVSVHVKTISTEDLPKDGVLIKVAYSGINYKDGLAGKAGGNIVREYPLILGIDAA
ADH2_KLULA      ----------------------------------------------------------------------
ADH2_BACST      -----KAAVVNEFKKAL--EIKEVERPKLEEGEVLVKIEACGVCHTDLHAAHGDWPIKPKLPLIPGHEGV
ADH1_KLUMA      -----------------------------KPNELLINVKYSGVCHTDLHAWQGDWPLDTKLPLVGGHEGA
RT4I1_MOUSE     ----------------------------------------------------------EEFPLTLGRDVS
QOR_CAVPO       -----------------------------KDHQVLIKVHACGINPVETYIRSGTYTRIPLLPYTPGTDVA
QOR_HUMAN       -----------------------------KDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVA
QOR_PIG         -----------------------------KDNQVLIKVHACGVNPVDTYIRSGTHNMKPLLPYTPGLDVA
RT4I1_BOVIN     ----------------------------------------------------------EEFPLTLGRDVS
QOR_PONAB       -----------------------------KDHQALIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVA
YBI2_SCHPO      --------------------------------DVLVEVVATSINPLDYKLMNTYAKALFKLPNIPGYDFA
RT4I1_HUMAN     ----------------------------------------------------------EEFPLTLGRDVS
QOR_BOVIN       -----------------------------KDHQVLIKVQACGVNPVDTYIRSGTHNIKPLLPYTPGFDVA
ADH1_NEUCR      ----------------------------------------------------------------------
ADH5_YEAST      -------------------EYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHEGA
ADH5_SACPS      -------------------EYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHEGA
RT4I1_DANRE     -----------------------------------------------------------EFPLILGRDVS
QOR_MOUSE       ---------------------------------VLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVA
ZDH1_STAAW      -----------------------------ENDDILVKVNSISVNPVDT---KQRQMEVTQAPRVLGFDAI
ZDH1_STAAS      -----------------------------ENDDILVKVNSISVNPVDT---KQRQMEVTQAPRVLGFDAI
ZDH1_STAAN      -----------------------------ENDDILVKVNSISVNPVDT---KQRQMKVTQAPRVLGFDAI
ZDH1_STAAM      -----------------------------ENDDILVKVNSISVNPVDT---KQRQMKVTQAPRVLGFDAI
QOR_LAMGU       ---------------------------------VLIKVQACGVNPVDTYIRSGTYSRKPRLPYTPGLDVA
ZDH1_STAAR      -----------------------------ENDDILVKVNSISVNPVDT---KQRQMEVTQAPRVLGFDAI
ZDH1_STAAC      -----------------------------ENDDILVKVNSISVNPVDT---KQRQMEVTQAPRVLGFDAI
QOR_YEAST       --------------------------------ELLIKNKYTGVNYIESYFRKGIYPCEK--PYVLGREAS
ADH3_BACST      ----------------------------------------------------------------------
PKS40_DICDI     ---------------NLEYKVKVKPTSILKENEVEIKVMSTGLNYKDYLIY---AGLVESVEPIFGIEFS
ADH1_BACST      ----------------------------------------------------------------------
QOR_RAT         ---------------------------------VLIKVHACGVNPVETYIRSGTYSRKPALPYTPGSDVA
ZDH1_STAES      ---------------------------------------------------------VDKVPRVLGFDAV
ZDH1_STAEQ      ---------------------------------------------------------VDKAPRVLGFDAV
QORH_SPIOL      -----------------------------KSDELLLKIEAATLNPIDWKIQKGVLRLPRKFPTIPGTDVA
PKS41_DICDI     ---------------NLEYKVKVKPTSILKENEVEIKVMSTGLNYKDYLIY---AGLVESVEPIFGIEFS
CADH1_ARATH     ----------------------------------------------------------------------
PTGR1_CAVPO     -------------------ELKTVELPPLKNGEVLLEALFLSVDP----YMRIASKRLKEGAVMMGQQVA
ADH2_KLUMA      ----------------------------------------------------------------------
ADH_STAAN       ----------------------------LKPGEALVQTEYCGVCHTDLHVKN------ADFGDVTGVTLG
ADH_STAAM       ----------------------------LKPGEALVQTEYCGVCHTDLHVKN------ADFGDVTGVTLG
YMN1_YEAST      ---------------------KELSSEQLKDGELLLETTYLSNDPAQKFWISNYAKGVQPGEIIPARGI-
ADH1_PICST      ----------------------------------------------------------------------
YOGA_BACSU      -----KAVIHNGKAGLLGLSVQDVPSTKPGYGEVKVKLKSAGLNHRDLFLMKNKS---EQDPHILGSD--
YGD6_SCHPO      ----------------------------LNPGEVLVKLKAASLNYRDLIITKGXXXXXXXXXXXXGSDGA
PKS45_DICDI     -------------------------QSNLKENEIEVQVVATGINFKDSLIFRNGDYSKPEF----GIECS
PTGR1_MOUSE     -------------------ELKTTELPPLNNGEVLLEALFLSVDP----YMRVAAKKLKEGDRMMGEQVA
ADH_STAAW       ----------------------------LKPGEALVQTEYCGVCHTDLHVKN------ADFGDVTGVTLG
ADH_STAAS       ----------------------------LKPGEALVQTEYCGVCHTDLHVKN------ADFGDVTGVTLG
ADH_STAAR       ----------------------------LKPGEALVQTEYCGVCHTDLHVKN------ADFGDVTGVTLG
ADH_STAAC       ----------------------------LKPGEALVQTEYCGVCHTDLHVKN------ADFGDVTGVTLG
ADH_STAAB       ----------------------------LKPGEALVQTEYCGVCHTDLHVKN------ADFGDVTGVTLG
ADH_STAA8       ----------------------------LKPGEALVQTEYCGVCHTDLHVKN------ADFGDVTGVTLG
ADH_STAA3       ----------------------------LKPGEALVQTEYCGVCHTDLHVKN------ADFGDVTGVTLG
ADH2_YEAST      ----------------------------------------------------------------------
PTGR1_BOVIN     -------------------ELKTVELPPLKDGEVLLEALYLTVDPYMRIM----AKSLKEGDMMMGEQVA
MECR_DANRE      -------------------QLESLDLPQVGAECVLVKMLAAPINPSDLNMLQGTYAILPELPAVGGNEGV
ADH1_KLULA      ----------------------------------------------------------------------
PTGR1_RABIT     -------------------ELKTVELPPLNNGEVLLEALFLSVDPYMRL----GSKRLKEGDTMMGQQVA
CADH3_ARATH     ----------------------------------------------------------------------
ADHA_BACSU      ----------------------------------------------------------------------
QORH_ARATH      -----------------------------KSNEVCLKLEATSLNPVDWKIQKGMIRLPRKFPCIPATDXX
CADH2_ARATH     ----------------------------------------------------------------------
ADH1_CAEEL      -------------------EVRQVPVPSPADDEILVKIEYSGICHSDLHVWLGDLKDMSVCPLVGGHEGA
QORL_ARATH      ----------------------------IKEDQVLIKVVAAALNPVDAKRRQGKFKATDSLPTVPGYXXX
QOR_LEIAM       ---NFKKLQVVSLSKDFRSSTSVVEAHLVPEGMVRVSVKYAGVNASDLNFTNGSYFKNVQPPFDCGFEAA
PKS44_DICDI     -------------------------QSNLKENEIEVQVVATGINFKDSLIFRNGDFSKPEF----GFECS
ADH2_PICST      ----------------------------------------------------------------------
ADH1_YEAST      ----------------------------------------------------------------------
QORL2_RAT       --------------------------------EVRVDVHFCGINFADNLVCRGQYQEKPPLPFTPGMEFS
QORL2_MOUSE     --------------------------------EVRVDVHFCGVNFADILACRGQYQEKPPLPFTPGMEFS
QORL2_BOVIN     --------------------------------EVRVNVHFCGINFADILACQGQYQERHQLPFTPGMEFS
PKS26_DICDI     --ENDKSLFVHLNA-NLEYELKSKQVK-LKQNEIEVNVKATGINYKDYLVINHKGESNPEFGH----DFS
CADH4_ORYSJ     --------------------------------DVSLRITHCGVCYADVIWTRNMFN-DSIYPLVPGHEIA
PTGR1_PIG       -------------------ELKTVELPPLKNGEVLLEALFLTVDP----YMRIAARKLKEGDMMMGEQVA
P2_ARATH        ----------------------------------------------------------------------
ADH3_KLULA      ----------------------------------------------------------------------
PTGR1_RAT       -------------------ELRTTELPPLNNGEVLLEALFLSVDP----YMRVAAKKLKEGDSMMGEQVA
PKS3_DICDI      -SESYQDLVENDLSPNLEYELKPMTKD-LEPFEVQVEIKSFALNYKDYLMVNHKTGDIND-PEF-GSDFS
ZADH2_BOVIN     -------LVVTRLSPNFREAVRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKTPFDAGFEGV
PTGR1_HUMAN     -------------------ELKTAELPPLKNGEVLLEALFLTVDP----YMRVAAKRLKEGDTMMGQQVA
ADH2_CANAL      ----------------------------------------------------------------------
QOR_PSEAE       ----------------------------------------------------------------------
P1_ARATH        ----------------------------------------------------------------------
ADH_SULAC       -----KAMLLHKFGEPLRLEDMDVPKVGV--GQVLVKVDYADLSVRSGAIFNRISSSKPTLPLVIGHEIA
ADH_SCHPO       ----------------------------------------------------------------------
PKS2_DICDI      --------------QNLQYQLKPFENK-IPEGFIEVKVLASGINFKDNLVYHTGNSNDPEF----GYECS
MCAS_MYCBO      -------------------------------GQIEVAVSMSSINFADVLIAFGRFPIIDDREPQLGMDFX
QOR_SALTY       -------------------------------------------------------------PSLPGTEAA
ADH1_EMENI      ----------------------------------------------------------------------
QOR_ECOLI       ----------------------------------------------------------------------
ZADH2_HUMAN     -------LVVTRLSPNF-REAVTLSRDLPGDGDLLVRVNASDINYS----AGRYDPSVKP-PFDIGFEGI
ADH2_EMENI      ----------------------------------------------------------------------
ADH1_ZYMMO      -----KAAVITKDH---TIEVKDTKLRPLKYGEALLEMEYCGVCHTDLHVKNGD--FGDETGRITGHEGI
ZADH2_MOUSE     ----------------------------------------------------------------------
ADH4_KLULA      -------------------EYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA
ADH2_CAEEL      -------------------EVRQVSVPQPQENELLVKIEYSGICHSDLHTWEGDFEYASICPLIGGHEGA
VAT1_DANRE      -------------------------KPALKSGEVMVRVKMCGLNFADLMARQGLYDRLPSPPVTPGMECS
ADH1_ASPFN      ----------------------------------------------------------------------
YBJB_SCHPO      -------------------EIQSVPIPQPKNGELLVKIEAAAINPSDLMNATGGFPYTV-YPRIVGRDYA
PKS16_DICDI     -------------------------KEKLPHGSVEIKVMSTGINYKDNLIFTKGDIYSPPF----GLECA
FAS_BOVIN       ----------------------------------------------------------------------
ETR1_YARLI      ----------------------------------------------------------------------
QORX_HUMAN      --------------------VKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEAS
DFRA_PYRCO      ----------------------------------------------------------------------
DFRA_MALDO      ----------------------------------------------------------------------
ADH3_YEAST      ----------------------------------------------------------------------
PTGR2_MOUSE     ----------------------------------------------------------------------
FAS_MOUSE       ----------------------------------------------------------------------
FAS_HUMAN       -------------------------------GAQLCTVYYASLNFRDIMLATG--KLSPDA--IPG---K
QORL1_MOUSE     -STNEEVTFVFQEKEN----VPVTEDNFVR-----VQVKACALSHINTKLLAE-MKMEKDFFPV-GREVS
PKS17_DICDI     -------------------------KEKLLHGCVEIKVMSTGINYKDSLVFSKGDIYSPPF----GLECA
FAS_CHICK       ----------------------------------------------------------------------
DHRS7_DICDI     ----------------------------------------------------------------------
DFRA_HORVU      ----------------------------------------------------------------------
YGI2_SCHPO      ----------------------------------------------------------------------
YBBO_ECOLI      ----------------------------------------------------------------------
YBBO_ECOL6      ----------------------------------------------------------------------
PKS37_DICDI     -------------------------------GQVLVRVEMCTLNFRDIL-----KSLGRDYDPIHGDEFS


                         .         .         *         .         .         .         .:140
query           GTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSF
YHDH_ECOLI      GTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTAMLC--
YHFP_BACSU      GTVVSSNDPRFAEGDEVIATSYELGVSRDGGLSEYASVPGDWLVPLPQNLSLKEAMVYGTAGFTAAL---
ADH2_KLULA      ------------------------GYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVYK---
ADH2_BACST      GIVVEAKGVKSIKGDRVCLTGQETGYSVDGGYAEYCKAPADYVAKIPDNLDPVEVAPILCAGVTTYK---
ADH1_KLUMA      GIVVAMGEN---------VTGWEIGDYHDGSFQQYATADAVQAARIPKNVDLAEVAPILCAGVTVYLKSA
RT4I1_MOUSE     GVVMECDVKYFQPGDEVAVPPWKQGTL-----SEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAIN
QOR_CAVPO       GVVIGNDVSAFKKGDRVFTTS-----TISGGYAEYALASDHTVYRLPEKLDFRQGAAIGIPYFTACRALF
QOR_HUMAN       GVIVGDNASAFKKGDRVFTSS-----TISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTALIHSA
QOR_PIG         GIVVGEHVSSFKKGDRVFTVS-----TLSGGYAEYALAADDTVYMLPEKLDFKQGAAIGIPYFTALLHSA
RT4I1_BOVIN     GVVMECDVRYFKPGDEVAVPPWKQGTL-----SEFVVVSGNEVSHKPRSLTHTQAASLPYVALTAWSAIN
QOR_PONAB       GVIVGGNASAFKKGDRVFTSS-----TISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTALIHSA
YBI2_SCHPO      GRVLAVGSE--VKEFSATQRVWRAGR--QGGSCATHIVTGDKDVHLPDGVSFNEGAGFGIAGLTAW----
RT4I1_HUMAN     GVVMECDVKYFKPGDEVAVPPWKQGTL-----SEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAIN
QOR_BOVIN       GIIVGESVSAFKKGDRVFTT-----RTISGGYAEYALAADHTVYTLPEKLDFKQGAAIGIPYFTALLHSA
ADH1_NEUCR      -----------------LLSGYTVD----GSFQQYAIAKAAHVAKIPKGCDLETTAPVLCAGITVY----
ADH5_YEAST      GVVVKLGSN---------VKGWKVGDFHDGTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITV----Y
ADH5_SACPS      GVVVKLGSN---------VKGWKVGDFHDGTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITV----Y
RT4I1_DANRE     GEIMECDVKYFKPGDQVAIPPWKQGSL-----AEFVVVSGNEVSHKPKSLRHDEAASIPYVAATAW--SA
QOR_MOUSE       G-IIESVGDKFKKGDRVFCYS-----TVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALF
ZDH1_STAAW      GTVIGPDVTLFSPGDVVFYAGSPNRQ---GSNATYQLVSEAIVAKAPHNISANEAVSLPLTGITAYETFF
ZDH1_STAAS      GTVIGPDVTLFSPGDVVFYAGSPNRQ---GSNATYQLVSEAIVAKAPHNISANEAVSLPLTGITAYETFF
ZDH1_STAAN      GTVIGPDVTLFSPGDVVFYAGSPNRQ---GSNATYQLVSEAIVAKAPHNISANEAVSLPLTGITAFFDTF
ZDH1_STAAM      GTVIGPDVTLFSPGDVVFYAGSPNRQ---GSNATYQLVSEAIVAKAPHNISANEAVSLPLTGITAFFDTF
QOR_LAMGU       GLIVGERVSAFKKGDRVFTTS-----TVSGGYAEYALAADHTVYKLPGELDFQKGAAIGVPYFTALLHSA
ZDH1_STAAR      GTVIGPNVTLFSPGDVVFYAGSPNRQ---GSNATYQLVSEAIVAKAPHNISANEAVSLPLTGITAFFDTF
ZDH1_STAAC      GTVIGPDVTLFSPGDVVFYAGSPNRQ---GSNATYQLVSEAIVAKAPHNISANEAVSLPLTGITAYETFF
QOR_YEAST       GTVVAKG-----KGVTNFEVGDQVAYISNSTFAQYSKISSQGPVMKLPKGTSDEELKLYAAGLLQVLT--
ADH3_BACST      -----------------------------GGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYK---
PKS40_DICDI     GIIIGSGNKEFKVGDSVYGTGKSTT-------SSHIITDIDVISHKPSNISHSEASSIPVVYLTSYHSLY
ADH1_BACST      -----------------------------GGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYK---
QOR_RAT         G-IIESVGSAFKKGDRVFCFS-----TVSGGYAEFALSADNTTYPLPETLDFRQGAALGIPYFTACRALF
ZDH1_STAES      GVIIGDQVSMFQEGDVVFYSG---SPNQNGSNEEYQLIEEYLVAKAPTNLKSEQAASLPLTGLTAYETLF
ZDH1_STAEQ      GVIIGDQVSMFQEGDVVFYSG---SPNQNGSNEEYQLIEEYLVAKAPTNLKSEQAASLPLTGLTAYETLF
QORH_SPIOL      GEVVQAGSARFKTGDKVVAV---LSHATGGALAEYAVAKENLTVARPPEVSXXXXXXXXXXXXXXXLTQF
PKS41_DICDI     GIIISTGSKEFKVGDHV----YGIGK---STTSSHIITDIDVISHKPSNISHSEASSIPVVYLTSYHSLY
CADH1_ARATH     ------------------------GSVTKGGYSSHIVVHERYCYKIPVDYPLESAAPLLCAGITV----Y
PTGR1_CAVPO     -RVVESKNSAFPAGSIVLASGWTTHFISDG--KGLEKLLTEWPDKLPLSLA------LGTIGMPGLTAYF
ADH2_KLUMA      ----------------------------------------------------------------------
ADH_STAAN       GKVIEAEDVESLKIGDRVSIAWNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK
ADH_STAAM       GKVIEAEDVESLKIGDRVSIAWNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK
YMN1_YEAST      GKVLASRNKAFSPGDYVAVTGWTTHAI-------ISQENVQGLRKLDKNKVGKYLSVLGGTSLTAYFIFF
ADH1_PICST      ------------------------GYTHDGSFQQYATADAVQAARLPKGTDLAQAAPILCAGITVYK---
YOGA_BACSU      GAXXXXXXXXXVKNTEVVILNWDLTEEILGGPSEYVIIPSQNAIKKPAYLSWEEAGVLPLSALTAYRALF
YGD6_SCHPO      GIIVGEDVEGFEKGDSVVATHSALGGTRDGCFQKYAVLPAHALVHAPKNLSFEEIATLPCAAVTAWNGLF
PKS45_DICDI     GIVIGSKVTKFKVGDSVLGISWKSTSSHAINYQ-------DAFVLKPDNISFVEA-----ASIPLVYCSF
PTGR1_MOUSE     -RVVESKNSAFPKGTIVALLGWTSHSIS----------DGNGLTKLPVEWPDKLSLALGTVGMPGLTAYF
ADH_STAAW       GKVIEAEDVESLKIGDRVSIAWNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK
ADH_STAAS       GKVIEAEDVESLKIGDRVSIAWNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK
ADH_STAAR       GKVIEAEDVESLKIGDRVSIAWNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK
ADH_STAAC       GKVIEAEDVESLKIGDRVSIAWNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK
ADH_STAAB       GKVIEAEDVESLKIGDRVSIAWNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK
ADH_STAA8       GKVIEAEDVESLKIGDRVSIAWNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK
ADH_STAA3       GKVIEAEDVESLKIGDRVSIAWNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK
ADH2_YEAST      ----------------------------------------------------------------------
PTGR1_BOVIN     -RVVESKNSAFPTGTIVLASGWTTHSISNG--EKLEKVLAEWPDTLPLSLA------LGTVGMPGLTAYF
MECR_DANRE      AQVMEGDKVKTLKGDWVI-----PKDAGIGTWRTAAVLKADDLVTLPKDIPVLSAATLGVNPCTAMLTDF
ADH1_KLULA      ----------------------------------------------------------------------
PTGR1_RABIT     -RVVESKNPAWPVGTLVLASGWASHSISDG--QQLEKLLTEWPDTLPLSLA------LGTVGMPGITAYF
CADH3_ARATH     -----------------------------GGYSDVIVVDHRFVLSIPDGLPSDSGAPLLCAGITVYS---
ADHA_BACSU      ------------------------GNPTYGGYSQKIVVTDRFVVRIPDRLEMDVASPLLCAGIT----TY
QORH_ARATH      XXXXXXXXKNFKAGDKVVAVLSHLGG---GGLAEFAVATEKLTVKRPQXXXXXXXXXXXXXXXXXLQ-AL
CADH2_ARATH     -----------------------------GGYSDVIVVDHRFVLSIPDGLPSDSGAPLLCAGITVYS---
ADH1_CAEEL      GSVVQIGKN---------VTGWQLGDMNFGTFQEYLTIRGVDAAKINKDTNLAAAAPILCAGVTVY----
QORL_ARATH      XXXXXXXXXXXXEGDEVVSEKALEGPKQFGSLAEYTAVEEKLLALKPKNIDFAQA-----AGL-----PL
QOR_LEIAM       GTVVQAGVANVKVGDHVVL-------MQYGCFAEFLDAPAERCIPVPE--LKPEYSVLPVSALTAAV---
PKS44_DICDI     GIVIGSKVKKFKVGDSVLGISWKSTSSHAINYQ-------DAFVLKPDNISFVEA-----ASIPIVYCSF
ADH2_PICST      ----------------------------------------------------------------------
ADH1_YEAST      ----------------------------------------------------------------------
QORL2_RAT       GVVLEADVSTVKKGDRVI------GVSNFHSMAEQCITDQKTLWRIPENVSLQDAAVLPVSYGTAIL---
QORL2_MOUSE     GAVLETDVSTVKKGDRVI------GVSSFHAMAEQCITDQKTLWRIPENVSLQDAAVLPVSYGTAIL---
QORL2_BOVIN     GMVLETDVSTVKEGDRVI------GLPGFSGMAEECITDHKNLWQIPEKVSLREAAALPVSYGTAI---F
PKS26_DICDI     GIITRIXXXXXXXXXE-FKVGDQVYGIWFNTTASHIIVDKEFLCHKPSKLSHTIASSIPVVYITSLYSLY
CADH4_ORYSJ     GVVTEADVKGFKVGDHVVVTYNSVGTVTKGGYSSHILVHQRYCFKIPADYPLSKAAPLLCAGITV----Y
PTGR1_PIG       -RVIESKNAAFPTGTIVVLLGWTTHSISDGK-------NLERLLAEWPD-TLPLSLTLGTVGMPGLTAYF
P2_ARATH        --VIESGHPDYKKGDLLWIVGWEE-------YSVITPMAHMHFKIQHTDVPSYYTGLLGMPGMTAYAGFY
ADH3_KLULA      ------------------------GYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVYLKSA
PTGR1_RAT       -RVVESKNSAFPTGTIVVLLGWTSHSISDG--NGLRKLPAEWPDKLPLSLA------LGTVGMPGLTAYF
PKS3_DICDI      GVITKNNCSEFKVGDQVYGTAYNTA-------SSKSIIDSGSIYFKPNNLSHEQASTIPVVYSTSLHSIY
ZADH2_BOVIN     GEVVALG----LSASAAFMVGQAVAYMAPGSFAEYTVVPARVAIPVPG--LKPEYLTLLVSGTTAYI---
PTGR1_HUMAN     -KVVESKNVALPKGTIVLASGWTTHSISDG------KDLEKLLTEWPDTIPLSLA--LGTVGMPGLTAYF
ADH2_CANAL      ----------------------------------------------------------------------
QOR_PSEAE       --------TRFKVGDRV---AYATGPL--GAYSELHVLAEEKLVHLPDGIDFEQAAAVMLKGLTT---QY
P1_ARATH        --IIESGHPDYKKGDLL----W--GIVAWEEYSVITPMTHAHFKIQHTDVPSYYTGLLGMPGMTAYAGFY
ADH_SULAC       XXXXXXXXXXFKKSDKVLIDPWKIGEDQYGGYGEYVLVPDYRYMFKLRNLSTSTASPLACSGVTAYRAL-
ADH_SCHPO       -----------MKAEETILSGYTVD----GTFQHYCIANATHATIIPESVPLEVAAPIMCAGIT---CYR
PKS2_DICDI      GIVSRVGDTKFKVGDEVVGLG-------FNCTGSFVTLEQFRFVLKPKNLTHVEAASIPVVYLTSYYSLF
MCAS_MYCBO      XXXXXXXXXXXXHQ-----VGDRVGGFSEGGWRTFLTCDANLAVTLPPGLTDEQXXXXXXXXXXXW---Y
QOR_SALTY       GVV-----SKVGNGVEHIRVGDRVAQSTLGAYSSVHNVTADKAAILPDAISFEQAAASFLKGLTVLRKTY
ADH1_EMENI      ----------------------------------------------------------------------
QOR_ECOLI       --------SKVGSGVKHIKAGDRVAQSALGAYSSVHNIIADKAAILPAAISFEQAAASFLKGLTVLRKTY
ZADH2_HUMAN     GEVVALGLSASAR----YTVGQAVAYMAPGSFAEYTVVPAS--IATPVPSVKPEYLTLLVSGTTAYI---
ADH2_EMENI      -----------------------------GTFQQYVLGPAQYVTPIPDGLPSAEAAPLLCAGVTV----Y
ADH1_ZYMMO      GIVKQASVAWFFKGCEYCVSGENAGYTVDGAMAEECIVVADYSVKVPDGLDPAVASSITCAGVTTYK---
ZADH2_MOUSE     ----------------------------------------------------------------------
ADH4_KLULA      GIVVAKGENKWLNGSELCEQGYESGYTHDGSFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVYK---
ADH2_CAEEL      GTVVTIGSKKLINANEYCKTGHEYGIDRHGTFQEYLTIRDIDAIKVSNDTNLAAAAPVLCGGVTAYKSLK
VAT1_DANRE      G-VIEA------VGEEV--TDRKVGDKVLGMWQEVVVVASTHTFLMPEGMSFEEAAALPVNYITAYMMLF
ADH1_ASPFN      ----------------------------------------------------------------------
YBJB_SCHPO      GTVI--SGASHLVGTRVFGTGSELSFTKDGTHAEYCIIPEKAAVRMPSNLSFTEAASVGVPFTTAYL---
PKS16_DICDI     GRVAPSGVTRFKVGDQVV--GFASHSL-----SSLAITHQDKIVLKPENISFNEAAAVCVVYATSYYSIF
FAS_BOVIN       ---------------------------------------------------------------------Y
ETR1_YARLI      ----------------------------FGTWRSHALVEADTVVKIDNDLTKVQATTVSVNPSTAY----
QORX_HUMAN      GHVAELGPG--CQGH------WKIGDTAMGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLH
DFRA_PYRCO      ----------------------------------------------------------------------
DFRA_MALDO      ----------------------------------------------------------------------
ADH3_YEAST      ----------------------------------------------------------------------
PTGR2_MOUSE     GVVEESKHQKLTKGDFVTSFYWP--------WQTKAILDGNGLEKDPQLVDGHLSYFLGAIGMPGLTSLI
FAS_MOUSE       ------------------------------GLATSVLLSSDFLWDVPSSWTLEEAASVPVVYTTAY---Y
FAS_HUMAN       WTSQDSLLGMEFSGRDA--SGKRVGLVPAKGLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAY---Y
QORL1_MOUSE     GIVLEVGRKVFQPDDEVV--GILPLDSEDPGLCEVIRVHEHYLVHKPEKVSWTEAAGVIRDGVRACTALY
PKS17_DICDI     GRVAPSGVTRFKVGDQVV--GFASHSL-----SSHVTTHQNKIVLKPENISFNEAAAVCVVYATSYYSIF
FAS_CHICK       ----------------------------------------------------------------------
DHRS7_DICDI     ------------------------------------------------------SIILPIASLYFIYCNF
DFRA_HORVU      ----------------------------------------------------------------------
YGI2_SCHPO      ----------------------------------------------------------------------
YBBO_ECOLI      ----------------------------------------------------------------------
YBBO_ECOL6      ----------------------------------------------------------------------
PKS37_DICDI     GKVIEIGEG---------VNNLSVGQYVFGSMGSFVCCNSDLVFXXXQEIISKLLNQYCTIPIVFLTSWY


                         +         .         .         .         .         *         .:210
query           AIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDK
YHDH_ECOLI      -VMALEDAGVRPQDGEIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTHEYLKSLGASRVLPR-DEFA
YHFP_BACSU      SVHRLEQNGLSPEKXXXXXXXXXXXXXXXXXXMLNKRGYDVVASTGNREAADYLKQLGASEVISREDVDG
ADH2_KLULA      ALKSAD-LKAGDWVA---ISGACGGLGSLAIQYAKAMGYRVLGIDTGAEKAKLFKELGGEYFVDYADLIK
ADH2_BACST      ALKVS-----GARPGEWVAIYGIGGLGHIALQYAKAMGLNVVAVDISDEKSKLAKDLGADIAINKEDPVK
ADH1_KLUMA      HIKAGDW---------VAISGACGGLGSLAIQYAKAMGYRVLGIDAGDEKAKLFKELGGEYFIDTKDMVA
RT4I1_MOUSE     KVGGLSDKNC--KGKRALILGASGGVGTFAIQVMKAWGAHVTAVCSKDASE-LVRKLGADEVIDYTLGSV
QOR_CAVPO       H-SARAKA--GESV---LVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKVVLQNGAHEVFNHRDIDE
QOR_HUMAN       CVKAGES---------VLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREIDK
QOR_PIG         CVKAGEI---------VLIHGASGGVGIAACQIARAYGLKVLGTAGTEEGQNIVLQNGAHEVFNHREIDK
RT4I1_BOVIN     KVGGLNDRNCTGK--RVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDASE-LVRKLGADDVIDYKSGNV
QOR_PONAB       HVKAGES---------VLVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKIVLQNGAHEVFNHREIDK
YBI2_SCHPO      -----EVLVRQMKVKKLVIEGASGGVGTFAVALAKALECEVTTIS-STENLDLCKSLGATHTLDYKKDNL
RT4I1_HUMAN     KVGG-----LNDKNKRVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDASE-LVRKLGADDVIDYKSGSV
QOR_BOVIN       CVKPGES---------VLVHGASGGVGIAACQIARAYGLKVLGTASTEEGQKIVLENGAHKVFNHKEAD-
ADH1_NEUCR      --KGLKESGV-RPGQCVAIVGAGGGLGSMAIQYANAMGLHAIAIDGGEEKGKNCRELGAQAYVDVADV-K
ADH5_YEAST      KALKRANVIPGQWVT---ISGACGGLGSLAIQYALAMGYRVIGIDGGNAKRKLFEQLGGEIFIDEKDIVG
ADH5_SACPS      KALKRANVIPGQWVT---ISGACGGLGSLAIQYALAMGYRVIGIDGGNAKRKLFEQLGGEIFIDEKDIVG
RT4I1_DANRE     IVNTGGLNKDNSAKKRVLILGGSGGVGTFAIQMVKAWGAHVT-VTCSQNAERLVRDLGADDVVDAGPVEK
QOR_MOUSE       SARARA----GESV---LVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEIDK
ZDH1_STAAW      DTFKISHNPAENEGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGADIVLNKEDLVR
ZDH1_STAAS      DTFKISHNPAENEGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGADIVLNKEDLVR
ZDH1_STAAN      KISHNPSENVG---KSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGADIVLNKEDLVR
ZDH1_STAAM      KISHNPSENVG---KSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGADIVLNKEDLVR
QOR_LAMGU       CAKAGES---------VLVHGASGGVGLAACQIARACCFKVLGTAGTEEGQRVVLQNGAHEVFNHREIDK
ZDH1_STAAR      KISHNPSENIG---KSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGADIVLNKEDLVR
ZDH1_STAAC      DTFKISTNPAENEGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGADIVLNKEDL--
QOR_YEAST       ALSFTNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHTIAVASTDEKLKIAKEYGAEYLINKEDILR
ADH3_BACST      ALK-----VTGAKPGEWVAIYGIGGLGHVAVQYAKAMGLNVVAVDIGDEKLELAKELGADLVVNKEDAAK
PKS40_DICDI     NIGALKNN------ETILIHSATGGVGLSTLEILKWKGHSIFVTVGSNEKEEYLR---------------
ADH1_BACST      ALK-----VTGAKPGEWVAIYGIGGLGHVAVQYAKAMGLNVVAVDLGDEKLELAKQLGADLVVNPKHDDA
QOR_RAT         SARARA----GESV---LVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFN----HK
ZDH1_STAES      DVFGISKEPSENKGKSLLIINGAGGVGSIATQIAKFYGLKVITTASREDTIKWSVNMGADVVLNKKDLSQ
ZDH1_STAEQ      DVFGISKEPSENKGKSLLIINGAGGVGSIATQIAKFYGLKVITTASREDTIKWSVNMGADVVLNKKDLSQ
QORH_SPIOL      AIKLDGS---GER-KNILITAASGGVGHYAVQLAKLGNTHVTATCG-ARNLDFVKGLGADEVLD------
PKS41_DICDI     NIGALKNN------ETILIHSATGGVGLSTLEILKWKGHSIFVTVGSNEKEEYLR---------------
CADH1_ARATH     APMMRHN--MNQPGKSLGVIGL-GGLGHMAVKFGKAFGLSVTVFTSISKKEEALNLLGAENFVISSDHDQ
PTGR1_CAVPO     GLLEVCGVKGGETV---LXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNS
ADH2_KLUMA      ------------------------------VQYAKAMGFRVLGIDGGEGKEELFKSLGGEVFIDSKDIVG
ADH_STAAN       VSNVKPGQWLG-------VFGI-GGLGNLALQYANVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDP
ADH_STAAM       VSNVKPGQWLG-------VFGI-GGLGNLALQYANVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDP
YMN1_YEAST      TLQEREE----DYGKVYLISGAAGAVGTVCIQLLNVFASKVIAIAGGPEKVAFVESFG-DNVVGVDYKDP
ADH1_PICST      ALKTAQI----QPGNWVCXXXXXXXXXXXXXQYAKAMGFRVIAIDGGEEKGEFVKSLGAEAYVDSKDIVK
YOGA_BACSU      ---TKGQLKKGE---HLLIPGIGSGVATYALFMAKAIGATVSVTSRSEEKRKKALKLGADYAFDSYS-NW
YGD6_SCHPO      GSKEHQ-----VKPXXXXXXXXXXXXSTFALQFALAAGANVTVTSSSDEKLEFAKKLGATHTINYKKTPQ
PKS45_DICDI     YSLFYSGNLKIENNESVLIHQASGGIGLACLNILKSCGFKLYVTVGSKEKEDYLR---------------
PTGR1_MOUSE     GLLDICGVKGGETV---MXXXXXXXXXXXXXQIAKLKGCKVVGTAGSDEKVAYLKKLGAFNYKTVKSLEE
ADH_STAAW       VSNVKPGQWLG-------VFGI-GGLGNLALQYANVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDP
ADH_STAAS       VSNVKPGQWLG-------VFGI-GGLGNLALQYANVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDP
ADH_STAAR       VSNVKPGQWLG-------VFGI-GGLGNLALQYANVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDP
ADH_STAAC       VSNVKPGQWLG-------VFGI-GGLGNLALQYANVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDP
ADH_STAAB       VSNVKPGQWLG-------VFGI-GGLGNLALQYANVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDP
ADH_STAA8       VSNVKPGQWLG-------VFGI-GGLGNLALQYANVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDP
ADH_STAA3       VSNVKPGQWLG-------VFGI-GGLGNLALQYANVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDP
ADH2_YEAST      ------------------------------VQYAKAMGYRVLGIDGGPGKEELFTSLGGEVFIDEKDIVS
PTGR1_BOVIN     GVKGGETVLXXXKLKGCKVVGTAGSDEKVAW--LKKHGFDV------ALNYKTVKSL--------EEALK
MECR_DANRE      -----EELKAGD---TVIQNAANSGVGQAVIQIAAAKGHTINVIRDRPDLRQLLTAMGATHVITEETL--
ADH1_KLULA      ------------------------------VQYAKAMGYRVLGIDAGEEKAKLFKDLGGEYFIDSKNIPE
PTGR1_RABIT     GLLE----ICGAKSGDVLVNXXXXXXXXXXXQIAKIKGCRVVGAAGSEEKVDYLKKIGFDFAFNYKTVKS
CADH3_ARATH     --PMKYYGMTKESGKRLGVNGL-GGLGHIAVKIGKAFGLRVTVISRSSEKERAIDRLGADSFLVTTDSQK
ADHA_BACSU      SPLKHWNVGPGKKVAIVGV----GGLGHLAIQFAHAMGAEVTVLSRSMNKKEEALELGANHYF--ATSDP
QORH_ARATH      TNPAGLKLDGTGKKANILVTAASGGVGHYAVQLAKLANAHVTATCG-ARNIEFVKSLGADEVLDYKTPEG
CADH2_ARATH     --PMKYYGMTKESGKRLGVNGL-GGLGHIAVKIGKAFGLRVTVISRSSEKERAIDRLGADSFLVTTDSQK
ADH1_CAEEL      --KALKESNVAPG-QIIVLTXXXXXXXXXXIQYACAMGMRVVAMD-HGSKEAHCKGLGAEWFVDAPDIVS
QORL_ARATH      AIETADEGLVRTEFKSILVLNGAGGVGSLVIQLAHVYGASKVAATASTEKLELVRSLGADLAIDYTKENI
QOR_LEIAM       ---ALGEVGRVKKGDVALVXXXXXXXXQIAVQLLKHYGCTVIGTCSSEEKAEFLKSIGCDHVINYKTESL
PKS44_DICDI     YSLFYSGNLSIKNNESVLIHQASGGIGLACLNILKSCGFKLYVTVGSKEKEDYLR---------------
ADH2_PICST      -------------------------------------GYRVVGIDGGADKGEFAKSLGAEDFLSSKDVVA
ADH1_YEAST      ------------------------------VQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDEKDIVG
QORL2_RAT       AVDHRARIQPGE--XXXXXXXXXXXXXXXIDVATNVFCAKVIAAAGSDEKCKLAMQRGAQSGVNYSQGSK
QORL2_MOUSE     AVDHRARIQPGE--XXXXXXXXXXXXXXXIDVATNVFRAKVIAATGSDEKCKLAVQRGAQFSVNYSQRDA
QORL2_BOVIN     ALEHRACTQPGEXXXXXXXXXXXXXXXDVATNILQA---KVIAAAGSDEKCQLAMQSGAQSSVNRGSLKE
PKS26_DICDI     NIGNIQN------DESILIHSASGGIGLSALNILKWKNHHIFVTVGSKEKEKYI----------------
CADH4_ORYSJ     TPMIRHN--MNQPGKSLGVIGL-GGLGHMAVKFGKAFGLKVTVFTSESKREEAINLLGADNFVISSD-EN
PTGR1_PIG       GLLDICGLKGGEKLKGCKVVGAAGSDEKVAC--LKKYGFDV------AFNYKTIESL--EETLKKASPEG
P2_ARATH        ------EVCSPKKGETVYVSAASGAVGQLVGQFAKMMGCYVVGSAGSKEKVDLLKTFGFDDAFNKEESDL
ADH3_KLULA      NLKAGDW---------VXXXXXXXXXXXXXVQYAKAMGYRVVGIDGGEEKGKLVKQLGGEAFVDTKDMVA
PTGR1_RAT       GLLDICGLKGGETXXXXXXXXXXXXXXXXXXKLK---GCKVVGTAGSDEKVAYLKKLGAFNYKTVKSLEE
PKS3_DICDI      NIGNLKNY------ESILIHSASGGVGLSSLNILKWKGHYIFLTVGSPEKEKYLR---------------
ZADH2_BOVIN     SLKELGGLSEGKKV---LVTAAAGGTGQFAVQLAKKAKCHVIGTCSSAEKSAFLKSVGCDRPINYNTEHV
PTGR1_HUMAN     GLLE----ICGVKGGETXXXXXXXXXXXXXXXXXXKLGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVES
ADH2_CANAL      ------------------------------VQYAKAMGYRVLAIDGGEDKGEFVKSLGAETFIDXXXXXX
QOR_PSEAE       LLRQTYELRGGETI---LFHAAAGGVGLFACQWAKALGVQLIGTVSSPEKARLARQHGAWETIDYSHENV
P1_ARATH        EVCSPKE---GETV---YVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTKDAFNYKEESDLTA
ADH_SULAC       ------RLANLDPSKSVMXXXXXXXXXXXXVQIAKAIGSFIIGVDVSEEGLKLATNLGADYVTSKVD-EE
ADH_SCHPO       ALK-ESKVGPGEWI---CIPGAGGGLGHLAVQYAKAMAMRVVAIDTGDDKAELVKSFGAEVFLDEADMIE
PKS2_DICDI      VAG----YLSIEKKESVLIHGGTGGIGLACINLLKAKGFKLFVTVGSKEKENFLR---------------
MCAS_MYCBO      GLNDLAQIKAGDKV---LIHSATGGVGQAAISIARAKGAEIFATAGNPAKRAMLRDMGVEHVYDSRSVEQ
QOR_SALTY       EVKPDEPFLFH---------AAAGGVGLIACQWAKALGAKLIGTVGSAQKAQRALDAGAWQVINEESIVE
ADH1_EMENI      -------------------------------------GIRVVAVDGGDEKRAMCESLGTETYVDSKDLVA
QOR_ECOLI       EIKPDEQFLFH---------AAAGGVGLIACQWAKALGAKLIGTVGTAQKAQSALKAGAWQVINEEDLVE
ZADH2_HUMAN     SLKELGGLSEGKKV---LVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINVGTVLK
ADH2_EMENI      ASLKRSKAQPGQWI---VISGAGGGLGHLAVQIAAKMGLRVIGV-DHGSKEELVKASGAEHFVDITKFPK
ADH1_ZYMMO      AVKV-SQIQPGQW----LAIYGLGGLGNLALQYANVFNAKVIAIDVNDEQLAFAKELGADMVINPKNEDA
ZADH2_MOUSE     --------------KKVLVTAAAGGTGQFAVQLSKIAKCHVIGTCSSDEKAAFLKSIGCDRPINYRTEPV
ADH4_KLULA      ALKTAD-LKPGQWVXXXXXXXXXXXXX---VQYAKAMGLRVLGIDGGDGKEELFKQCGGEVFIDSKDMVA
ADH2_CAEEL      ATNVKPGQI-------VVLTXXXXXXXXXXIQYAKAMGMRVVAVD-HISKEDHCRNLGAEDAFDTPDIVA
VAT1_DANRE      DFGHL------RPNQSVLVHMAAGGVG-IAATQLCKTVNDVTVFTASASKHEVISQGGVTHPIDTRDYVE
ADH1_ASPFN      -------------------------------------GIRVVAIDGGEEKQAMCEQLGAEAYVDVADV-K
YBJB_SCHPO      ----------------------------------------------------------------------
PKS16_DICDI     HIGA----FMADK-ESILVHSATGGVGLATLNLL------------------------------------
FAS_BOVIN       ALMVRGRMQPGETV---LIHSGSGGVGQAAIAIALSLGCRVFPLVGSAEKRAYLQSLNETSFANSRDTSF
ETR1_YARLI      ------EMLKDLKEGDWFINGGNSGVGRAAIQIGHIRGLSISVVRDRPDLEKELTDLGATHVITEEEASD
QORX_HUMAN      LV---GNVQAGDY---VLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNKEDFSE
DFRA_PYRCO      ---------MGSESESVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHL-------------
DFRA_MALDO      ---------MGSESESVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHL-------------
ADH3_YEAST      ----------------------------------------------------------------------
PTGR2_MOUSE     GVQEKGHISAGSN-QTMVVXXXXXXXXXXXXQIGHLLGCSVVGICGTQEKCLFLTSLGFDAAVNTGNVAE
FAS_MOUSE       SLVVRGRIQRGETV---LIHSGSGGVGQAAISIALSLGCRVFTTVGSAEKRAYLQALDDTSFANSRDTSF
FAS_HUMAN       ALVVRGRVRPGETL---LIHSGSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQAR-----FPQLDSTS
QORL1_MOUSE     YLS---QLSPG---KSVLIMDGASAFGTIAIQLAHHRGAKVISTAHSLEDKQHLERL-------------
PKS17_DICDI     HIGA----FIADK-ESILVHSATGGVGLASLNLL------------------------------------
FAS_CHICK       -----------KKGESVLIHSGSGGVGQAAIAIALSMGCRVFATVGSAEKREYLQA--------------
DHRS7_DICDI     APKLREKPESSYKNKVVIITGASSGIGAELAKKYARLGCKVTIVARRLDQLEKVKSSFLKDYSRVNDDD-
DFRA_HORVU      ----------------VVVTGASGFVGSWLVMKLLQAGYTVRATVRDPANVEKTKPLGAKERLSKADLSE
YGI2_SCHPO      ----------------IFVTGAAGFIGSEIVRQLLEAGHEVVGLVRSEENAAKLRAAGGTPYIGTLE---
YBBO_ECOLI      ------EILTGKVMKSVLITGCSSGIGLESALELKRQGFHVLAGCRKPDDVERMNSMGFTGVL--IDLD-
YBBO_ECOL6      ------EILTGKVMKSVLITGCSSGIGLESALELKRQGFHVLAGCRKPDDVERMNSMGFTGVL--IDLD-
PKS37_DICDI     SIVIQGRLKKGEKI---LIHSGCGGVGLATIQISMMIGAEIHVTVGSNEKKQYLFGIDEKRIYSSRSLDL


                         .         .         .         +         .         .         .:280
query           DARPLDKGLWDGVVDTVGGKILANALAQTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASI
YHDH_ECOLI      ESRPLEKQVWAGAIDTVGDKVLAKVLAQMNYXXXXXXXXXXXXFTLPTTVMPFILRNVRLQGVDSVMTPP
YHFP_BACSU      TLKALSKQQWQGAVDPVGGKQLASLLSKIQYGGSVAVSGLTGGGEVPATVYPFILRGVSLLGIDSVYCPM
ADH2_KLULA      EIVDATNGGAHGVINSVSEFAIEQSTNYVRSNGTVVLVGLPRDAKCKSDVFTQVVKSVSIVG--------
ADH2_BACST      AIHDQVGGVHAAISVAVNKKAFEQAYQSVKRGGTLVVVG-LPNADLPIPIFDTVLNGVSVKG--SIVGTR
ADH1_KLUMA      EVIEATNGVAHAVINSVSEAAISTSVLYTRSNGTVVLVGLPRDAQCKSDVFNQVVKSISIVG--------
RT4I1_MOUSE     EEQLKSLKLFDFILDNVGGSTETWALNFLK---------KWSGATYVTLVTPFLLNMDRL-GVTGVTVGT
QOR_CAVPO       IKKSIGEKGVDVIIEMLANVNLSNDLKLLSCGGRVIIVGCRGSIEINTMAKESTISGVSLF---------
QOR_HUMAN       IKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEIN-----------------------
QOR_PIG         IKKSVGEKGIDVIIEMXXXXXXXXXXXXXSHGGRVIIVGSRGPIEINTMTKGSSIKGVALY---------
RT4I1_BOVIN     EAQLKSSKPFDFILDNVGG---------------------------------------------------
QOR_PONAB       IKKYVGEKGIDVIIEMLANVNLNKDLSLLSHGGQVIVVGSRGTIEIN-----------------------
YBI2_SCHPO      VERLADLGPYDFVFDCVNDNVLYRASSKVKPDGAFFGIGSYVGSRLSRTLRPRVLGGSSHSYYNILLHVD
RT4I1_HUMAN     EEQLKSLKPFDFILDNVGG---------------------------------------------------
QOR_BOVIN       ----------------------------------------------------------------------
ADH1_NEUCR      AATPDGLGPHAVILLAVSEKPFHQAVDYVRSRGTIICIGLPAGAKFQAPVFDTVIRMITIKG-----SYV
ADH5_YEAST      AIIKATNGGSHGVINSVSEAAIEASTRYCRPNGTVVLVGMPAHAYCNSDVFNQVVKSISIVG-SCVGNRA
ADH5_SACPS      AIIKATNGGSHGVINSVSEAAIEASTRYCRPNGTVVLVGMPAHAYCNSDVFNQVVKSISIVG-SCVGNRA
RT4I1_DANRE     QLKNLEK--FDLILDSIGGETLITPFLQNTDRLGLADGMMQSAVTVGCKVVKNLRKGVHYWGFFAPSGS-
QOR_MOUSE       SVGDKDKGV-DVIIEMLANENLSNDL--------------------------------------------
ZDH1_STAAW      QFKEKEIPLVDYIFCTYNTDLYYNTMIE------------------------------------------
ZDH1_STAAS      QFKEKEIPLVDYIFCTYNTDLYYNTMIE------------------------------------------
ZDH1_STAAN      QFKEKEIPLVDYIFCTYNTDLYYNTMIE------------------------------------------
ZDH1_STAAM      QFKEKEIPLVDYIFCTYNTDLYYNTMIE------------------------------------------
QOR_LAMGU       IKKSVGEKGIDVIIEMXXXXXXXXXXXXXSQGGRVIIVGSKGPVEINTMTKESSIKGVTLF---------
ZDH1_STAAR      QFKEKEIPLVDYIFCTYNTDLYYNTMIE------------------------------------------
ZDH1_STAAC      ----------------------------------------------------------------------
QOR_YEAST       QVLKFTNGKGDASFDSVGKDTFEISLAALKRKGVFVSFGNASG-----LIPPFSITRLSPKNITLVIADP
ADH3_BACST      FMKEKXXXXXXXXXXXXSKPAFQSAYNSIRRGGACVLVGLPPE-EMPIPIFDTVLNGIKI--IGSIVGTR
PKS40_DICDI     ----------------------------------------------------------------------
ADH1_BACST      AQWIKEKXXXXXXXXXXXXSKAASAYKSIRRGGACVLVGLPPE-EIPIPIFDTVLNGVKI--IGSIVGTR
QOR_RAT         EANYIDK---------------------------------------------------------------
ZDH1_STAES      ----------------------------------------------------------------------
ZDH1_STAEQ      ----------------------------------------------------------------------
QORH_SPIOL      ----------------------------------------------------------------------
PKS41_DICDI     ----------------------------------------------------------------------
CADH1_ARATH     -MKALEKSL-DFLVDTASGDHAFDPMSLLKIAGTYVLVGFPSEIKISPANLNL--------GMRMLAGSV
PTGR1_CAVPO     LEEALKKASPDGYFDNVGGEFLNTVLSQMKDFGKIAICGAISVY--------------------------
ADH2_KLUMA      EVIKATNGGAHGVINSVSEKAIESSIEYCRSNGTVVLVGLPKDAKCKSDVFNQVVKSIHIVG--------
ADH_STAAN       VAEVMNKGL-DATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQD
ADH_STAAM       VAEVMNKGL-DATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQD
YMN1_YEAST      SFKQKGENTVDYFIDNVGSNVLEAGVLLLKQRAMLIACGAISAY--------------------------
ADH1_PICST      DIQTADGGPHAAINVSVSEKAIAQSCQYVRSTGTVVLVGLPAGAKVVAPVFDAVVKSISIRG--------
YOGA_BACSU      DEQLQGKKI-DVVLDSIGPALFSEYFRHVKPNGRIVSFGASSGDNLSFPVRSLFFPQVNVLG----TSMG
YGD6_SCHPO      WASPMTNGVYHHVIEVGGEKTLPQSIACLAKDGMISMIGEGTTPNLTSIIGQILNRNANIRGIFVGSVSM
PKS45_DICDI     ----------------------------------------------------------------------
PTGR1_MOUSE     ALRTASPDGYDCYFDNVGGEFSNAVILQMKTFGRIAICGAISQY--------------------------
ADH_STAAW       VAEVMNKGL-DATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQD
ADH_STAAS       VAEVMNKGL-DATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQD
ADH_STAAR       VAEVMNKGL-DATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQD
ADH_STAAC       VAEVMNKGL-DATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQD
ADH_STAAB       VAEVMNKGL-DATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQD
ADH_STAA8       VAEVMNKGL-DATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQD
ADH_STAA3       VAEVMNKGL-DATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQD
ADH2_YEAST      AVVKATNGGAHGIINSVSEAAIEASTRYCRANGTVVLVGLPAGAKCSSDVFNHVVKSISIVG--------
PTGR1_BOVIN     EAAPEG---YDCYFDNVGGEFSNVAITQMKKFGRIAICGAISVYNRTSPLSPIIFKELHLQGFVVYRWQG
MECR_DANRE      -RRPEMKELFKSALNGVGGKSATELLRHLQSGGSLVTYGGMAKQPVTVPVSALIFKDVRVRG--------
ADH1_KLULA      EVIEATKGGAHGVINSVSEFAIEQSTNYVRSNGTVVLVGLPRDAKCKSDVFNQVVKSISIVG--------
PTGR1_RABIT     LEETLKKAAPDGYFDNVGGEFSNTVIRQMKKFGRVAICGAISMYNSTGQLPPGPSPESVLY------QEI
CADH3_ARATH     MKEAV--GTMDFIIDTVSAEALLPLFSLLKVSGKLVALG-LLEKPLDLPIFPLVL-GRKMVGGSQIGG--
ADHA_BACSU      ATFTALAGRFDVILNTVSANLDVDALSMLRIDGTLVSVGKPDTYSVFSLIM----------GRRSIAGSL
QORH_ARATH      AALKSPSGKYDAVVHCANGIPFSVFEPNLSENGKVIDITPGPNAMWTYAVKKITMSKKQLVPLLLIPKA-
CADH2_ARATH     MKEAV--GTMDFIIDTVSAEALLPLFSLLKVNGKLVALG-LPEKPLDLPIFSLVL-GRKMVGGSQIGG--
ADH1_CAEEL      HITKLTEGGPHGVINAVARKPMEQAVEYVRKRGTVVFVGLPKDSKVTFDTTPFIFNAITIKG------SI
QORL_ARATH      EDLP-DK--YDVVFDAIG--MCDKAVKVIKEGGKVVALTGA-----------------------------
QOR_LEIAM       DGRLHEKGV-DVVYECVGGHTFNDXXXXXXXXXXXXIIGSISSYK-SGEVVPF-----------------
PKS44_DICDI     ----------------------------------------------------------------------
ADH2_PICST      DVLKATNGGAHGVINSVSERAMQQSVDYVRPTGTVVLVGLPAGAKXXXXXXXXXXRTIQIKG--------
ADH1_YEAST      AVLKATDGGAHGVINSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVG--------
QORL2_RAT       DAKLVGSSGVNVAIDMVGGDVFLDSLRSLAWEGRIVVLGFAGGNIASVPSNLLLLKNISAMGL-------
QORL2_MOUSE     VKKLAGSGGVNVAIDMVGGDVFLESLRSLAWEGRIVVLGFAGGNIASVPSNLLLLKNISAMGL-------
QORL2_BOVIN     AVGKLGSGGVNVVIDMVGGDIFLEALRSLAYEGRIVVVGFAGGTIASVPANLLLLKNVSAMGL-------
PKS26_DICDI     ----------------------------------------------------------------------
CADH4_ORYSJ     QMESLKSSL-HFIIDTASGDHQFDPLSLLKVGGVMVLLSFPSEIKVHPENLNLAARSL----AGSVTGGT
PTGR1_PIG       ---------YDCYFDNVGGEFSNAVTSQMKKFGRIAICGAISTYNRTXXXXXXXXXEVVIYNELCFQGFI
P2_ARATH        SARCFPKGI-DMYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNL------------------------
ADH3_KLULA      EIQEITNGGPHGVINVSVSEAAMNASTQVRPTGTVVLVGLPAGAVIKSEVFSHVVKSINIKG--------
PTGR1_RAT       ALRTASPDGYDCYFDNVGGEFSNTVILQMKTFGRIAICGAISQY--------------------------
PKS3_DICDI      ----------------------------------------------------------------------
ZADH2_BOVIN     GTQEYPQGV-DVVYESVGGAMFDLAVDALATRGRLIVIGFVSGYQTPTGLSP------------------
PTGR1_HUMAN     LEETLKKASPDGYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTXXXXXXXXXEIVIYQELRMEAFV
ADH2_CANAL      XXXXXTNGGPHGVINSVSERAIGQSTEYVRTLGKVVLVGLPAGAKISTPVFDAVIKTIQIKG--------
QOR_PSEAE       ARRVLE--LTDGVYDSVGKDTWETSLDCVAPRGLLVSFGNAS----------------------------
P1_ARATH        ALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNL------------------------
ADH_SULAC       EVRKITTGRGDAIIDFVGSEFTSNYYTLLAKLGRYVKVGTYGGGLPHDAGLRLHSMGWQFIG----TLTG
ADH_SCHPO       AVKAATNGGAHGLVLSTSPKSYEQAAGFARPGSTMVTVSMPAGAKLGADIFWLTVKMLKICG--------
PKS2_DICDI      ----------------------------------------------------------------------
MCAS_MYCBO      IRRDTDGYGVDIVLNSLTGAAQRAGLELLAFGGRFVEIGKADVYNTRLGLFPF-RRGLTFYALMSVTQPD
QOR_SALTY       RVKEITGGKKVRVVDSVGKDTWEASLDCLQRRGLMVSFGNAS----------------------------
ADH1_EMENI      DATPDGLGAHAVILLAVSEKPFQQATEYVRSRGTIVAIGLPPDAYLKAPVINTVVRMITIKG-----SYV
QOR_ECOLI       RLKEITGGKKVRVVDSVGRDTWERSLDCLQRRGLMVSFGNSS----------------------------
ZADH2_HUMAN     QEYP--EGV-DVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSP------------------
ADH2_EMENI      SLTTKGLGAHAVIVCTASNIAYAQSLLFLRYNGTMVCVGPENEPQAIASAYPFIQKHVHVTGVGNRNEAI
ADH1_ZYMMO      AKIIQEKXXXXXXXXXXXXXKSASAVEAIRAGGRVVAVGLPPE-KMDLSIPRLVLDGIEVLG-----SLV
ZADH2_MOUSE     ETQEYPEGV-DVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQSPTGLSPLLKKSASLRGFSKYQAAM
ADH4_KLULA      DIQEATNGGPHGVINSVSEAAISMSTEYVRPTGVVVLVGLPADAYVKSEVFSHVVKSISIKG--------
ADH2_CAEEL      HIRKLTNGGAHGVVSFAAAKKMEYALEYVRKRGTVVFVGLPKDGTIPLDTLSLICNEI------TVKGSI
VAT1_DANRE      EVRKISPKGLDIVLDPLGG---------------------------------------------------
ADH1_ASPFN      AATPEGLGAHAVILLAVAEKPFQQAAEYVRSRGTVVAIGLPAGAFLRAPVFNTVVRMINIKG--------
YBJB_SCHPO      ----------------------------------------------------------------------
PKS16_DICDI     ----------------------------------------------------------------------
FAS_BOVIN       EQHVLGKGA-DLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSKNHPLGMAIFLKNVTFHGI-LLDSLF
ETR1_YARLI      KLFSKQIKSWTGALNCIGGKSATSIMRQLGAGGSIVTYGGMSKKPLTFPTGPFIFKDITAKGYWLTRWAD
QORX_HUMAN      ATLKFTKGAGNLILDCIGG---------------------------------------------------
DFRA_PYRCO      ----------------------------------------------------------------------
DFRA_MALDO      ----------------------------------------------------------------------
ADH3_YEAST      DIQEATKGGPHGVINSVSEAAISLSTEYVRPCGTVVLVGLPANAYVKSEVFSHVVKSINIKG--------
PTGR2_MOUSE     QLREACPGGVDVYFDNVGGDISNAVISQMNENSHIILCGQISQY--------------------------
FAS_MOUSE       EQHVLGKGV-DLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHPLGMAIFLKNVTFHGI-LLDALF
FAS_HUMAN       FANSRDTSFEQHVLWHTGGKLVLNSLAEEK----------------------------------------
QORL1_MOUSE     ----------------------------------------------------------------------
PKS17_DICDI     ----------------------------------------------------------------------
FAS_CHICK       ----------------------------------------------------------------------
DHRS7_DICDI     ----------------------------------------------------------------------
DFRA_HORVU      D---------------------------------------------------------------------
YGI2_SCHPO      DLDTLKKGVCDGVIHT------------------------------------------------------
YBBO_ECOLI      ----------------------------------------------------------------------
YBBO_ECOL6      ----------------------------------------------------------------------
PKS37_DICDI     MVNTDGQGV-DMVLNSLSGEYLEKSIQCLSQYGRFIEIGKKDIYSNSSIHLEPFKNNLSFFAVDIAQMTE


                         .         *         .         .         .         .         +:350
query           KRREFVWNEVKSLIDFEQLEKSIKTVSLEDLIDIYPKMLKGETSGRYIVDLNK
YHDH_ECOLI      ERRAQAWQRLVADLPESFYTQAAKEISLSEAPNFAEAIINNQIQGRTLVKVN-
YHFP_BACSU      DVRAAVWERMSSDLKPDQLLTIVREVSLEETPGALKDILQNRIQGRVIVKL--
ADH2_KLULA      ---SYVGNDTREALDFFAVHAPIKIVGLSELADVYDKMVKGEIVGRYVVDTSK
ADH2_BACST      K-------DMQEALDFAKVRPIVETAELEEINEVFERMEKGKINGRIVLKLKE
ADH1_KLUMA      ---SYVGNDTREALDFFSVKAPIKILGLSELASVYDKMVKGQIVGRIVVDTSK
RT4I1_MOUSE     KALKHLWDEIAELVDAGKIRPVIRTFPFSEVPEAFLKVERGHARGKTVVNV--
QOR_CAVPO       -----------------------------------------------------
QOR_HUMAN       -----------------------------------------------------
QOR_PIG         -----------------------------------------------------
RT4I1_BOVIN     -----------------------------------------------------
QOR_PONAB       -----------------------------------------------------
YBI2_SCHPO      QEM------LRDFVDF-VMKHNIKTVDFEDTVEAFNRLMTHRCKGKVII----
RT4I1_HUMAN     -----------------------------------------------------
QOR_BOVIN       -----------------------------------------------------
ADH1_NEUCR      GNRQ----DTQEALDFGLIKVPIKTVGLSKLQEVYDLMEEGKIVGRYVVDTSK
ADH5_YEAST      DTREALDFFARGLI-----KSPIHLAGLSDVPEIFAKMEKGEIVGRYVVETSK
ADH5_SACPS      DTREALDFFARGLI-----KSPIHLAGLSDVPEIFAKMEKGEIVGRYVVETSK
RT4I1_DANRE     -----ALDEVSEMVDAGKVRPVVEEVSFAQVPEAFQKVEQGHARGKTVVSI--
QOR_MOUSE       -----------------------------------------------------
ZDH1_STAAW      -----------------------------------------------------
ZDH1_STAAS      -----------------------------------------------------
ZDH1_STAAN      -----------------------------------------------------
ZDH1_STAAM      -----------------------------------------------------
QOR_LAMGU       -----------------------------------------------------
ZDH1_STAAR      -----------------------------------------------------
ZDH1_STAAC      -----------------------------------------------------
QOR_YEAST       EEWKYYSDEFFGLVNSKKLNKIYKTYPLRDYRTAAADIESRKTVGKLVLEI--
ADH3_BACST      K-------DLQEALQF-AAEGKVKTIPLEKINEVFDRMLKGQINGRVVLTL--
PKS40_DICDI     -----------------------------------------------------
ADH1_BACST      K-------DLQEALQF-AAEGKVKTIPLENINDVFDRMLKGQINGRVVLKVD-
QOR_RAT         -----------------------------------------------------
ZDH1_STAES      -----------------------------------------------------
ZDH1_STAEQ      -----------------------------------------------------
QORH_SPIOL      -----------------------------------------------------
PKS41_DICDI     -----------------------------------------------------
CADH1_ARATH     TGGTKITQQMLDFCAAHKIYPNIEVIPIQKINEALERVVKKDIKYRFVIDI--
PTGR1_CAVPO     -----------------------------------------------------
ADH2_KLUMA      ---SYVGNDTREALDFGLVNAPIKVVGLSTLPEIYEKMEQGKVLGRYVVDTSK
ADH_STAAN       LREAFEFAAENKVTPKVQLRK------LEEINDIFEEMEKGTITGRMVI----
ADH_STAAM       LREAFEFAAENKVTPKVQLRK------LEEINDIFEEMEKGTITGRMVI----
YMN1_YEAST      -----------------------------------------------------
ADH1_PICST      ---SYVGNRADSAIDFFTIKCPIKVVGLSELPKVYELMEAGKVIGRYVVDTSK
YOGA_BACSU      SGEEF--QAMLAFIDKHKLRPVIDRIPLEKACEAYKRMQEGRQFG--------
YGD6_SCHPO      FRDMVACIEAKDIFPFDQLKEA-------------------------------
PKS45_DICDI     -----------------------------------------------------
PTGR1_MOUSE     -----------------------------------------------------
ADH_STAAW       LREAFEFAAENKVTPKVQLRK------LEEINDIFEEMENGTITGRMVI----
ADH_STAAS       LREAFEFAAENKVTPKVQLRK------LEEINDIFEEMENGTITGRMVI----
ADH_STAAR       LREAFEFAAENKVTPKVQLRK------LEEINDIFEEMENGTITGRMVI----
ADH_STAAC       LREAFEFAAENKVTPKVQLRK------LEEINDIFEEMENGTITGRMVI----
ADH_STAAB       LREAFEFAAENKVTPKVQLRK------LEEINDIFEEMENGTITGRMVI----
ADH_STAA8       LREAFEFAAENKVTPKVQLRK------LEEINDIFEEMENGTITGRMVI----
ADH_STAA3       LREAFEFAAENKVTPKVQLRK------LEEINDIFEEMENGTITGRMVI----
ADH2_YEAST      ---SYVGNDTREALDFRGLVKSIKVVGLSSLPEIYEKMEKGQIAGRYVVDTSK
PTGR1_BOVIN     EVRQKALRDLLKWVSEGKIQHEHVTEGFENMPAAFIGLLKGENLGKAIV----
MECR_DANRE      -----------------------------------------------------
ADH1_KLULA      ---SYVGNDTREAIDFFSVKAPIHVVGLSELPSIYEKMEKGAIVGRYVVDTSK
PTGR1_RABIT     RMEGFIFNRWKGEVGQKALKELLTWVGFENMPAAFMRMLKGENVGK-------
CADH3_ARATH     ------MKETQEMLEFHKIVSDIELIKMSDINSAMDRLVKSDVRYRFVIDV--
ADHA_BACSU      VGG---IQETQEMLDFHGIEPKIEVIGADQVDEAYERILRSDVRYRFVIDIS-
QORH_ARATH      ENLEFMVNLVK--------EGKVKTVPLSKAEDAWAKSIDGHATGKIIVE---
CADH2_ARATH     ------MKETQEMLEFHKIVSDIELIKMSDINSAMDRLAKSDVRYRFVIDV--
ADH1_CAEEL      VGSRLDVDEAMEFVTRGIVKVPLELVKLEDVPAVYQRMLDGKINSRAVVDFS-
QORL_ARATH      -----------------------------------------------------
QOR_LEIAM       -----------------------------------------------------
PKS44_DICDI     -----------------------------------------------------
ADH2_PICST      ---SYVGNRADSAIDFFTIKCPIKIVGLSELASVYELMEQGKILGRYVVDTSK
ADH1_YEAST      ---SYVGNDTREALDFRGLVKSIKVVGLSTLPEIYEKMEKGQIVGRYVVDTSK
QORL2_RAT       -----------------------------------------------------
QORL2_MOUSE     -----------------------------------------------------
QORL2_BOVIN     -----------------------------------------------------
PKS26_DICDI     -----------------------------------------------------
CADH4_ORYSJ     K-------DIQEMINFNNVYPDIEMIKIDYVNEALQRLINRDVRFRFVIDI--
PTGR1_PIG       VTRWQGEVRQKALRDLLKWVSEGKTEGFENMPAAFMGMLKGENLGKAIV----
P2_ARATH        -----------------------------------------------------
ADH3_KLULA      ---SYVGNDTREAINFGHVHSPIKVVGLSELPKVYELMEQGKILGRYVVD---
PTGR1_RAT       -----------------------------------------------------
PKS3_DICDI      -----------------------------------------------------
ZADH2_BOVIN     -----------------------------------------------------
PTGR1_HUMAN     ARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIV----
ADH2_CANAL      ---SYVGNDTAEAVDFFTIKCPIKIVGLSELPEVYKLMEEGKILGRYVLDNDK
QOR_PSEAE       -----------------------------------------------------
P1_ARATH        -----------------------------------------------------
ADH_SULAC       NRKDFL--EVLELAENGKIKPMIKVLSLEEANDALDNLEKGKVSGRQVL----
ADH_SCHPO       ---SHVGNRIDSIEALEYVSRGLKVQPFSTLPDVYRLMHENKIAGRIVLDLSK
PKS2_DICDI      -----------------------------------------------------
MCAS_MYCBO      RVRELLATVFKLTADGVLTAPQCTHYPLAEAADAIRAMSNAEHTGKLVLDV--
QOR_SALTY       -----------------------------------------------------
ADH1_EMENI      GNRQ---DGVEALDFFARIKAPFKTAPLKDLPKIYELMEQGRIAGRYVLEM--
QOR_ECOLI       -----------------------------------------------------
ZADH2_HUMAN     -----------------------------------------------------
ADH2_EMENI      ETMEFAARGV--------IKAHFREEKMEALTEIFKEMEEGKLQGRVVLDLS-
ADH1_ZYMMO      GTRE----DLKEAFQFAKVKPKVTKRKVEEINQIFDEMEHGKFTGRMVVD---
ZADH2_MOUSE     ERELYARGDLVCEVDLGHLAPDGRFIGLESVFQAVDYMYTGKNTGKLVVEL--
ADH4_KLULA      ---SYVGNDTREATDFRGLVKSIKIIGLSELPEAYELMEQGKILGRFVVDTYK
ADH2_CAEEL      VGSRMDVDEAIDFITRGIVHVPIELVKLEDVPSVYQRMKDGKVTSRVVVDFS-
VAT1_DANRE      -----------------------------------------------------
ADH1_ASPFN      ---SYVGNRQDGVVDFFAIKAPFKTAPLQDLPKIFELMEQGKIAGRYVLEI--
YBJB_SCHPO      -----------------------------------------------------
PKS16_DICDI     -----------------------------------------------------
FAS_BOVIN       EENNTMWQEVSTLL---------------------------------------
ETR1_YARLI      KHPEEKAKTIENIFKFYREKKFV------------------------------
QORX_HUMAN      -----------------------------------------------------
DFRA_PYRCO      -----------------------------------------------------
DFRA_MALDO      -----------------------------------------------------
ADH3_YEAST      ---SYVGNDTREALDFFSIKSPIKIVGLSELPKVYDLMEKGKILGRYVVDTSK
PTGR2_MOUSE     -----------------------------------------------------
FAS_MOUSE       EEANDSWREVAALLKAGIRDGVVKPLKCAQVEDAFRYMAQGKHIGKVLVQVRE
FAS_HUMAN       -----------------------------------------------------
QORL1_MOUSE     -----------------------------------------------------
PKS17_DICDI     -----------------------------------------------------
FAS_CHICK       -----------------------------------------------------
DHRS7_DICDI     -----------------------------------------------------
DFRA_HORVU      -----------------------------------------------------
YGI2_SCHPO      -----------------------------------------------------
YBBO_ECOLI      -----------------------------------------------------
YBBO_ECOL6      -----------------------------------------------------
PKS37_DICDI     NRRDYLRE-----IMIDQLLPCFKNGSLKPL----------------------