[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ22049.1

[Show Plain Result]


## Summary of Sequence Search
    1::202
    1::202     e-113 100%  202 aa  GCH1_PELUB RecName: Full=GTP cyclohydrolase 1;       
   18::204     1e-64  57%  205 aa  GCH1_MARMM RecName: Full=GTP cyclohydrolase 1;       
   26::211     3e-61  57%  213 aa  GCH1_BRUSU RecName: Full=GTP cyclohydrolase 1;       
   26::211     3e-61  57%  213 aa  GCH1_BRUSI RecName: Full=GTP cyclohydrolase 1;       
   26::211     3e-61  57%  213 aa  GCH1_BRUME RecName: Full=GTP cyclohydrolase 1;       
   26::211     3e-61  57%  213 aa  GCH1_BRUMB RecName: Full=GTP cyclohydrolase 1;       
   26::211     3e-61  57%  213 aa  GCH1_BRUC2 RecName: Full=GTP cyclohydrolase 1;       
   26::211     3e-61  57%  213 aa  GCH1_BRUAB RecName: Full=GTP cyclohydrolase 1;       
   26::211     3e-61  57%  213 aa  GCH1_BRUA2 RecName: Full=GTP cyclohydrolase 1;       
   26::211     3e-61  57%  213 aa  GCH1_BRUA1 RecName: Full=GTP cyclohydrolase 1;       
   26::211     1e-60  56%  213 aa  GCH1_BRUO2 RecName: Full=GTP cyclohydrolase 1;       
   17::199     3e-60  56%  206 aa  GCH1_HYPNA RecName: Full=GTP cyclohydrolase 1;       
   10::212     4e-59  54%  212 aa  GCH1_CAUCR RecName: Full=GTP cyclohydrolase 1;       
   17::204     7e-58  53%  206 aa  GCH1_BARQU RecName: Full=GTP cyclohydrolase 1;       
   19::201     1e-57  55%  205 aa  GCH1_SINMW RecName: Full=GTP cyclohydrolase 1;       
   11::194     2e-57  51%  203 aa  GCH1_XYLFM RecName: Full=GTP cyclohydrolase 1;       
   17::204     2e-57  53%  206 aa  GCH1_BARHE RecName: Full=GTP cyclohydrolase 1;       
   11::194     6e-57  50%  203 aa  GCH1_XYLFA RecName: Full=GTP cyclohydrolase 1;       
   11::194     1e-56  51%  200 aa  GCH1_XANCP RecName: Full=GTP cyclohydrolase 1;       
   10::201     2e-56  52%  205 aa  GCH1_RHISN RecName: Full=GTP cyclohydrolase 1;       
   11::194     2e-56  51%  203 aa  GCH1_XYLFT RecName: Full=GTP cyclohydrolase 1;       
   11::194     2e-56  51%  203 aa  GCH1_XYLF2 RecName: Full=GTP cyclohydrolase 1;       
   11::194     3e-56  51%  200 aa  GCH1_XANC5 RecName: Full=GTP cyclohydrolase 1;       
   11::194     5e-56  50%  200 aa  GCH1_XANAC RecName: Full=GTP cyclohydrolase 1;       
    6::192     5e-56  52%  197 aa  GCH1_RHILO RecName: Full=GTP cyclohydrolase 1;       
   13::200     1e-55  52%  204 aa  GCH1_RHIME RecName: Full=GTP cyclohydrolase 1;       
   27::208     2e-55  53%  213 aa  GCH1_OCHA4 RecName: Full=GTP cyclohydrolase 1;       
   38::225     9e-55  51%  229 aa  GCH1_RHOPT RecName: Full=GTP cyclohydrolase 1;       
   38::225     9e-55  51%  229 aa  GCH1_RHOPA RecName: Full=GTP cyclohydrolase 1;       
   26::199     9e-55  54%  206 aa  GCH1_BARBK RecName: Full=GTP cyclohydrolase 1;       
   29::215     2e-54  49%  219 aa  GCH1_METS4 RecName: Full=GTP cyclohydrolase 1;       
   38::225     5e-54  52%  229 aa  GCH1_RHOP2 RecName: Full=GTP cyclohydrolase 1;       
   38::225     8e-54  51%  229 aa  GCH1_RHOPS RecName: Full=GTP cyclohydrolase 1;       
   43::230     1e-53  52%  234 aa  GCH1_RHOPB RecName: Full=GTP cyclohydrolase 1;       
   11::198     4e-53  50%  201 aa  GCH1_AGRVS RecName: Full=GTP cyclohydrolase 1;       
   23::205     7e-53  51%  208 aa  GCH1_AGRT5 RecName: Full=GTP cyclohydrolase 1;       
   41::214     3e-52  51%  218 aa  GCH1_AZOC5 RecName: Full=GTP cyclohydrolase 1;       
   40::223     1e-51  52%  229 aa  GCH1_THEEB RecName: Full=GTP cyclohydrolase 1;       
   39::208     1e-51  53%  213 aa  GCH1_BEII9 RecName: Full=GTP cyclohydrolase 1;       
   19::205     4e-50  48%  213 aa  GCH1_SYNP6 RecName: Full=GTP cyclohydrolase 1;       
   19::205     4e-50  48%  213 aa  GCH1_SYNE7 RecName: Full=GTP cyclohydrolase 1;       
   30::189     4e-50  56%  222 aa  GCH1_MESSB RecName: Full=GTP cyclohydrolase 1;       
   52::225     5e-50  51%  229 aa  GCH1_BRAJA RecName: Full=GTP cyclohydrolase 1;       
   36::223     1e-49  49%  229 aa  GCH1_SYNJB RecName: Full=GTP cyclohydrolase 1;       
    4::191     3e-49  45%  192 aa  GCH1_RICBR RecName: Full=GTP cyclohydrolase 1;       
    4::191     3e-49  45%  192 aa  GCH1_RICB8 RecName: Full=GTP cyclohydrolase 1;       
    3::189     4e-49  44%  190 aa  GCH1_RICTY RecName: Full=GTP cyclohydrolase 1;       
   40::228     1e-48  46%  235 aa  GCH1_NOSP7 RecName: Full=GTP cyclohydrolase 1;       
   54::228     2e-48  50%  235 aa  GCH11_ANASP RecName: Full=GTP cyclohydrolase 1 1;       
   49::223     3e-48  51%  229 aa  GCH1_SYNJA RecName: Full=GTP cyclohydrolase 1;       
   46::221     4e-48  51%  224 aa  GCH1_CHLTE RecName: Full=GTP cyclohydrolase 1;       
   45::223     5e-48  52%  223 aa  GCH1_CHLCH RecName: Full=GTP cyclohydrolase 1;       
    2::182     6e-48  51%  184 aa  GCH1_FINM2 RecName: Full=GTP cyclohydrolase 1;       
   44::227     8e-48  47%  234 aa  GCH1_SYNY3 RecName: Full=GTP cyclohydrolase 1;       
    3::189     8e-48  43%  190 aa  GCH1_RICPR RecName: Full=GTP cyclohydrolase 1;       
    3::184     8e-48  52%  185 aa  GCH1_CLOPE RecName: Full=GTP cyclohydrolase 1;       
   46::221     1e-47  52%  223 aa  GCH1_PROVI RecName: Full=GTP cyclohydrolase 1;       
    2::184     1e-47  50%  185 aa  GCH1_CLOPS RecName: Full=GTP cyclohydrolase 1;       
   33::208     2e-47  49%  214 aa  GCH1_GLOVI RecName: Full=GTP cyclohydrolase 1;       
    2::184     2e-47  50%  185 aa  GCH1_CLOP1 RecName: Full=GTP cyclohydrolase 1;       
    3::189     3e-47  45%  190 aa  GCH1_RICFE RecName: Full=GTP cyclohydrolase 1;       
   46::222     5e-47  47%  223 aa  GCH1_CAEEL RecName: Full=GTP cyclohydrolase 1;       
    3::183     7e-47  49%  190 aa  GCH1_CAMJ8 RecName: Full=GTP cyclohydrolase 1;       
    3::183     9e-47  49%  190 aa  GCH1_CAMJR RecName: Full=GTP cyclohydrolase 1;       
    3::189     1e-46  44%  190 aa  GCH1_RICAH RecName: Full=GTP cyclohydrolase 1;       
   24::209     1e-46  47%  216 aa  GCH12_ANASP RecName: Full=GTP cyclohydrolase 1 2;       
    3::183     2e-46  48%  190 aa  GCH1_CAMJE RecName: Full=GTP cyclohydrolase 1;       
    3::183     2e-46  48%  190 aa  GCH1_CAMJD RecName: Full=GTP cyclohydrolase 1;       
    8::182     3e-46  51%  196 aa  GCH1_CORGL RecName: Full=GTP cyclohydrolase 1;       
   10::184     4e-46  47%  184 aa  GCH1_COXBU RecName: Full=GTP cyclohydrolase 1;       
   10::184     4e-46  47%  184 aa  GCH1_COXBR RecName: Full=GTP cyclohydrolase 1;       
   10::184     4e-46  47%  184 aa  GCH1_COXBN RecName: Full=GTP cyclohydrolase 1;       
    1::182     5e-46  49%  185 aa  GCH1_CLOK5 RecName: Full=GTP cyclohydrolase 1;       
    1::182     5e-46  49%  185 aa  GCH1_CLOK1 RecName: Full=GTP cyclohydrolase 1;       
    3::183     5e-46  48%  190 aa  GCH1_CAMJJ RecName: Full=GTP cyclohydrolase 1;       
    2::188     5e-46  47%  190 aa  GCH1_BACA2 RecName: Full=GTP cyclohydrolase 1;       
    2::188     8e-46  47%  190 aa  GCH1_BACSU RecName: Full=GTP cyclohydrolase 1;       
    8::182     1e-45  50%  196 aa  GCH1_CORGB RecName: Full=GTP cyclohydrolase 1;       
   60::234     1e-45  48%  236 aa  GCH1_CHICK RecName: Full=GTP cyclohydrolase 1;       
   65::239     2e-45  47%  241 aa  GCH1_RAT RecName: Full=GTP cyclohydrolase 1;       
    3::188     3e-45  43%  189 aa  GCH1_RICPU RecName: Full=GTP cyclohydrolase 1;       
    3::188     3e-45  43%  189 aa  GCH1_RICM5 RecName: Full=GTP cyclohydrolase 1;       
    1::185     4e-45  46%  187 aa  GCH1_WOLSU RecName: Full=GTP cyclohydrolase 1;       
   52::228     9e-45  46%  232 aa  GCH1_DICDI RecName: Full=GTP cyclohydrolase 1;       
   38::234     1e-44  42%  235 aa  GCH1_SCHPO RecName: Full=GTP cyclohydrolase 1;       
    3::188     1e-44  43%  189 aa  GCH1_RICAE RecName: Full=GTP cyclohydrolase 1;       
    5::184     1e-44  50%  187 aa  GCH1_STRSY RecName: Full=GTP cyclohydrolase 1;       
    5::184     1e-44  50%  187 aa  GCH1_STRS2 RecName: Full=GTP cyclohydrolase 1;       
    3::188     1e-44  42%  189 aa  GCH1_RICRS RecName: Full=GTP cyclohydrolase 1;       
    3::188     1e-44  42%  189 aa  GCH1_RICRO RecName: Full=GTP cyclohydrolase 1;       
    3::188     1e-44  42%  189 aa  GCH1_RICCN RecName: Full=GTP cyclohydrolase 1;       
    2::198     2e-44  48%  201 aa  GCH1_STRAW RecName: Full=GTP cyclohydrolase 1;       
    3::186     2e-44  48%  189 aa  GCH1_BACAH RecName: Full=GTP cyclohydrolase 1;       
    1::182     3e-44  49%  184 aa  GCH1_STRPN RecName: Full=GTP cyclohydrolase 1;       
    1::182     3e-44  49%  184 aa  GCH1_STRPJ RecName: Full=GTP cyclohydrolase 1;       
    1::182     3e-44  49%  184 aa  GCH1_STRP7 RecName: Full=GTP cyclohydrolase 1;       
    1::182     3e-44  49%  184 aa  GCH1_STRP4 RecName: Full=GTP cyclohydrolase 1;       
    1::182     3e-44  49%  184 aa  GCH1_STRR6 RecName: Full=GTP cyclohydrolase 1;       
    1::182     3e-44  49%  184 aa  GCH1_STRP2 RecName: Full=GTP cyclohydrolase 1;       
    6::183     3e-44  47%  190 aa  GCH1_CAMC5 RecName: Full=GTP cyclohydrolase 1;       
    4::180     3e-44  46%  181 aa  GCH1_AZOVD RecName: Full=GTP cyclohydrolase 1;       
    6::191     4e-44  46%  193 aa  GCH1_PORGI RecName: Full=GTP cyclohydrolase 1;       
    6::191     4e-44  46%  193 aa  GCH1_PORG3 RecName: Full=GTP cyclohydrolase 1;       
    2::178     4e-44  47%  183 aa  GCH1_LEPIN RecName: Full=GTP cyclohydrolase 1;       
    2::178     4e-44  47%  183 aa  GCH1_LEPIC RecName: Full=GTP cyclohydrolase 1;       
    2::178     4e-44  47%  183 aa  GCH1_LEPBL RecName: Full=GTP cyclohydrolase 1;       
    2::178     4e-44  47%  183 aa  GCH1_LEPBJ RecName: Full=GTP cyclohydrolase 1;       
    1::189     6e-44  51%  192 aa  GCH1_STRMU RecName: Full=GTP cyclohydrolase 1;       
    2::198     6e-44  47%  201 aa  GCH1_STRCO RecName: Full=GTP cyclohydrolase 1;       
    8::188     6e-44  50%  202 aa  GCH1_MYCVP RecName: Full=GTP cyclohydrolase 1;       
    8::188     6e-44  50%  202 aa  GCH1_MYCGI RecName: Full=GTP cyclohydrolase 1;       
   74::239     6e-44  48%  241 aa  GCH1_MOUSE RecName: Full=GTP cyclohydrolase 1;       
    4::180     6e-44  45%  181 aa  GCH12_PSEAE RecName: Full=GTP cyclohydrolase 1 2;       
    9::193     7e-44  48%  194 aa  GCH1_STRPY RecName: Full=GTP cyclohydrolase 1;       
    2::184     7e-44  48%  192 aa  GCH1_CARHZ RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACWK RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACHK RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACCZ RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACCR RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACCQ RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACC7 RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACC4 RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACC3 RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACC2 RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACC1 RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACC0 RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACAN RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACAC RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-44  48%  189 aa  GCH1_BACAA RecName: Full=GTP cyclohydrolase 1;       
    7::184     7e-44  45%  186 aa  GCH12_PSEPK RecName: Full=GTP cyclohydrolase 1 2;       
    8::191     1e-43  48%  207 aa  GCH1_THEFY RecName: Full=GTP cyclohydrolase 1;       
    1::182     1e-43  49%  184 aa  GCH1_STRZP RecName: Full=GTP cyclohydrolase 1;       
    1::182     1e-43  49%  184 aa  GCH1_STRZJ RecName: Full=GTP cyclohydrolase 1;       
    1::182     1e-43  49%  184 aa  GCH1_STRPS RecName: Full=GTP cyclohydrolase 1;       
    1::182     1e-43  49%  184 aa  GCH1_STRPI RecName: Full=GTP cyclohydrolase 1;       
    1::182     1e-43  49%  184 aa  GCH1_STRZT RecName: Full=GTP cyclohydrolase 1;       
    6::184     1e-43  43%  185 aa  GCH1_METCA RecName: Full=GTP cyclohydrolase 1;       
    3::186     1e-43  46%  189 aa  GCH1_BACP2 RecName: Full=GTP cyclohydrolase 1;       
    6::182     1e-43  45%  185 aa  GCH1_ALHEH RecName: Full=GTP cyclohydrolase 1;       
   18::186     2e-43  50%  201 aa  GCH1_STRGG RecName: Full=GTP cyclohydrolase 1;       
    3::186     2e-43  47%  189 aa  GCH1_BACCN RecName: Full=GTP cyclohydrolase 1;       
   19::181     2e-43  49%  196 aa  GCH1_PARD8 RecName: Full=GTP cyclohydrolase 1;       
   13::191     2e-43  45%  198 aa  GCH1_JANMA RecName: Full=GTP cyclohydrolase 1;       
    4::185     2e-43  47%  197 aa  GCH1_COREF RecName: Full=GTP cyclohydrolase 1;       
    3::186     4e-43  49%  187 aa  GCH1_STRA5 RecName: Full=GTP cyclohydrolase 1;       
   49::226     4e-43  48%  229 aa  GCH1_RHOBA RecName: Full=GTP cyclohydrolase 1;       
    6::183     4e-43  47%  190 aa  GCH1_CAMLR RecName: Full=GTP cyclohydrolase 1;       
    3::186     5e-43  49%  187 aa  GCH1_STRA1 RecName: Full=GTP cyclohydrolase 1;       
   83::248     5e-43  47%  250 aa  GCH1_HUMAN RecName: Full=GTP cyclohydrolase 1;       
    8::186     5e-43  49%  187 aa  GCH1_DESRM RecName: Full=GTP cyclohydrolase 1;       
   15::213     6e-43  44%  213 aa  GCH1_OSTOS RecName: Full=GTP cyclohydrolase 1;       
    6::183     6e-43  47%  190 aa  GCH1_CAMC1 RecName: Full=GTP cyclohydrolase 1;       
    2::178     1e-42  46%  183 aa  GCH1_LEPBP RecName: Full=GTP cyclohydrolase 1;       
    2::178     1e-42  46%  183 aa  GCH1_LEPBA RecName: Full=GTP cyclohydrolase 1;       
    9::184     1e-42  45%  186 aa  GCH11_PSEAE RecName: Full=GTP cyclohydrolase 1 1;       
    9::193     1e-42  47%  194 aa  GCH1_STRPG RecName: Full=GTP cyclohydrolase 1;       
    9::193     1e-42  47%  194 aa  GCH1_STRP8 RecName: Full=GTP cyclohydrolase 1;       
    9::193     1e-42  47%  194 aa  GCH1_STRP6 RecName: Full=GTP cyclohydrolase 1;       
    9::193     1e-42  47%  194 aa  GCH1_STRP3 RecName: Full=GTP cyclohydrolase 1;       
    9::193     1e-42  47%  194 aa  GCH1_STRP1 RecName: Full=GTP cyclohydrolase 1;       
   23::190     1e-42  49%  204 aa  GCH1_MYCA9 RecName: Full=GTP cyclohydrolase 1;       
    9::193     2e-42  47%  194 aa  GCH1_STRPZ RecName: Full=GTP cyclohydrolase 1;       
    3::186     2e-42  48%  187 aa  GCH1_STRA3 RecName: Full=GTP cyclohydrolase 1;       
    8::177     2e-42  51%  188 aa  GCH1_PELTS RecName: Full=GTP cyclohydrolase 1;       
    9::194     2e-42  46%  196 aa  GCH1_CORA7 RecName: Full=GTP cyclohydrolase 1;       
   10::186     2e-42  50%  189 aa  GCH1_LYSSC RecName: Full=GTP cyclohydrolase 1;       
   10::179     2e-42  49%  187 aa  GCH1_BREBN RecName: Full=GTP cyclohydrolase 1;       
    3::173     7e-42  50%  188 aa  GCH1_THEPX RecName: Full=GTP cyclohydrolase 1;       
    3::173     7e-42  50%  188 aa  GCH1_THEP3 RecName: Full=GTP cyclohydrolase 1;       
    3::173     7e-42  49%  187 aa  GCH1_STRT2 RecName: Full=GTP cyclohydrolase 1;       
    3::173     7e-42  49%  187 aa  GCH1_STRT1 RecName: Full=GTP cyclohydrolase 1;       
    4::186     7e-42  47%  188 aa  GCH1_GEOSW RecName: Full=GTP cyclohydrolase 1;       
    3::186     7e-42  46%  188 aa  GCH1_BACHD RecName: Full=GTP cyclohydrolase 1;       
   13::180     7e-42  46%  194 aa  GCH1_BACFR RecName: Full=GTP cyclohydrolase 1;       
   13::180     7e-42  46%  194 aa  GCH1_BACFN RecName: Full=GTP cyclohydrolase 1;       
    3::185     9e-42  46%  188 aa  GCH1_THETN RecName: Full=GTP cyclohydrolase 1;       
   64::226     1e-41  48%  243 aa  GCH1_YEAST RecName: Full=GTP cyclohydrolase 1;       
    3::186     1e-41  45%  188 aa  GCH1_GEOKA RecName: Full=GTP cyclohydrolase 1;       
   13::180     1e-41  47%  196 aa  GCH1_BACTN RecName: Full=GTP cyclohydrolase 1;       
    4::185     2e-41  46%  189 aa  GCH1_DEHSC RecName: Full=GTP cyclohydrolase 1;       
    4::185     2e-41  46%  189 aa  GCH1_DEHSB RecName: Full=GTP cyclohydrolase 1;       
    3::188     2e-41  44%  190 aa  GCH1_CLOD6 RecName: Full=GTP cyclohydrolase 1;       
    5::184     2e-41  47%  187 aa  GCH1_STRGC RecName: Full=GTP cyclohydrolase 1;       
    3::182     3e-41  41%  184 aa  GCH1_CHRSD RecName: Full=GTP cyclohydrolase 1;       
  135::309     8e-41  45%  313 aa  GCH1_NEUCR RecName: Full=GTP cyclohydrolase 1;       
    5::199     8e-41  43%  202 aa  GCH1_MYCTU RecName: Full=GTP cyclohydrolase 1;       
    5::199     8e-41  43%  202 aa  GCH1_MYCTA RecName: Full=GTP cyclohydrolase 1;       
    5::199     8e-41  43%  202 aa  GCH1_MYCBT RecName: Full=GTP cyclohydrolase 1;       
    5::199     8e-41  43%  202 aa  GCH1_MYCBP RecName: Full=GTP cyclohydrolase 1;       
    5::199     8e-41  43%  202 aa  GCH1_MYCBO RecName: Full=GTP cyclohydrolase 1;       
    4::187     1e-40  44%  189 aa  GCH1_DEHE1 RecName: Full=GTP cyclohydrolase 1;       
   22::202     1e-40  44%  205 aa  GCH1_MYCLE RecName: Full=GTP cyclohydrolase 1;       
   22::202     1e-40  44%  205 aa  GCH1_MYCLB RecName: Full=GTP cyclohydrolase 1;       
    3::185     2e-40  45%  187 aa  GCH1_CLOTH RecName: Full=GTP cyclohydrolase 1;       
    3::182     2e-40  44%  187 aa  GCH1_SULSY RecName: Full=GTP cyclohydrolase 1;       
    3::181     2e-40  44%  185 aa  GCH1_PERMH RecName: Full=GTP cyclohydrolase 1;       
   13::184     2e-40  47%  191 aa  GCH1_NITMU RecName: Full=GTP cyclohydrolase 1;       
    9::201     3e-40  43%  204 aa  GCH1_MYCPA RecName: Full=GTP cyclohydrolase 1;       
    4::186     4e-40  46%  189 aa  GCH1_LISW6 RecName: Full=GTP cyclohydrolase 1;       
    9::184     5e-40  43%  187 aa  GCH11_PSESM RecName: Full=GTP cyclohydrolase 1 1;       
    5::185     6e-40  45%  188 aa  GCH1_THEYD RecName: Full=GTP cyclohydrolase 1;       
    9::201     1e-39  42%  204 aa  GCH1_MYCA1 RecName: Full=GTP cyclohydrolase 1;       
    4::186     1e-39  46%  189 aa  GCH1_LISMO RecName: Full=GTP cyclohydrolase 1;       
    4::186     1e-39  46%  189 aa  GCH1_LISMH RecName: Full=GTP cyclohydrolase 1;       
    4::186     1e-39  46%  189 aa  GCH1_LISMF RecName: Full=GTP cyclohydrolase 1;       
    4::186     1e-39  46%  189 aa  GCH1_LISMC RecName: Full=GTP cyclohydrolase 1;       
    4::186     1e-39  46%  189 aa  GCH1_LISIN RecName: Full=GTP cyclohydrolase 1;       
   12::181     1e-39  51%  199 aa  GCH1_BIFLD RecName: Full=GTP cyclohydrolase 1;       
    9::184     2e-39  41%  184 aa  GCH1_PSEA6 RecName: Full=GTP cyclohydrolase 1;       
   18::154     2e-39  55%  184 aa  GCH1_STRSV RecName: Full=GTP cyclohydrolase 1;       
   40::198     2e-39  48%  216 aa  GCH1_DEIRA RecName: Full=GTP cyclohydrolase 1;       
    5::183     5e-39  46%  185 aa  GCH1_CLONN RecName: Full=GTP cyclohydrolase 1;       
   66::225     7e-39  48%  225 aa  GCH1_ONCMY RecName: Full=GTP cyclohydrolase 1;       
    4::182     9e-39  41%  184 aa  GCH1_PSEHT RecName: Full=GTP cyclohydrolase 1;       
    2::178     9e-39  41%  180 aa  GCH1_HELPY RecName: Full=GTP cyclohydrolase 1;       
    2::178     9e-39  42%  180 aa  GCH1_HELP2 RecName: Full=GTP cyclohydrolase 1;       
   12::181     1e-38  51%  199 aa  GCH1_BIFLO RecName: Full=GTP cyclohydrolase 1;       
    4::181     1e-38  44%  184 aa  GCH1_AQUAE RecName: Full=GTP cyclohydrolase 1;       
    2::178     2e-38  42%  180 aa  GCH1_HELPJ RecName: Full=GTP cyclohydrolase 1;       
    2::178     2e-38  42%  180 aa  GCH1_HELPG RecName: Full=GTP cyclohydrolase 1;       
    9::182     2e-38  41%  188 aa  GCH1_HAHCH RecName: Full=GTP cyclohydrolase 1;       
    4::180     2e-38  41%  181 aa  GCH12_PSESM RecName: Full=GTP cyclohydrolase 1 2;       
   32::199     2e-38  46%  202 aa  GCH1_MYCUA RecName: Full=GTP cyclohydrolase 1;       
   32::199     2e-38  46%  202 aa  GCH1_MYCMM RecName: Full=GTP cyclohydrolase 1;       
  151::345     4e-38  41%  349 aa  FOLKE_LACLA RecName: Full=Bifunctional protein folKE;Includes:
    2::178     5e-38  41%  180 aa  GCH1_HELPS RecName: Full=GTP cyclohydrolase 1;       
   45::217     5e-38  48%  223 aa  GCH1_FLAJ1 RecName: Full=GTP cyclohydrolase 1;       
    2::178     8e-38  41%  180 aa  GCH1_HELPH RecName: Full=GTP cyclohydrolase 1;       
  158::337     8e-38  44%  349 aa  FOLKE_LACLM RecName: Full=Bifunctional protein folKE;Includes:
    7::183     1e-37  40%  184 aa  GCH1_TERTT RecName: Full=GTP cyclohydrolase 1;       
   11::189     4e-37  43%  189 aa  GCH1_LACPL RecName: Full=GTP cyclohydrolase 1;       
   13::189     7e-37  40%  190 aa  GCH11_PSEPK RecName: Full=GTP cyclohydrolase 1 1;       
  136::322     1e-36  37%  324 aa  GCH1_DROME RecName: Full=GTP cyclohydrolase 1;       
    3::190     2e-36  43%  195 aa  GCH1_CLOAB RecName: Full=GTP cyclohydrolase 1;       
    9::180     4e-36  41%  182 aa  GCH1_HYDS0 RecName: Full=GTP cyclohydrolase 1;       
    2::178     4e-36  39%  180 aa  GCH1_HELAH RecName: Full=GTP cyclohydrolase 1;       
    3::179     7e-36  45%  193 aa  GCH1_HYPBU RecName: Full=GTP cyclohydrolase 1;       
    8::174     1e-35  48%  186 aa  GCH1_ENTFA RecName: Full=GTP cyclohydrolase 1;       
    3::175     6e-35  39%  187 aa  GCH1_FUSNN RecName: Full=GTP cyclohydrolase 1;       
   21::173     8e-35  46%  191 aa  GCH1_LEIXX RecName: Full=GTP cyclohydrolase 1;       
    5::188     1e-34  40%  189 aa  GCH1_LACSS RecName: Full=GTP cyclohydrolase 1;       
   28::204     2e-34  40%  206 aa  GCH1_HELHP RecName: Full=GTP cyclohydrolase 1;       
    3::191     5e-34  40%  195 aa  GCH1_CLOCE RecName: Full=GTP cyclohydrolase 1;       
    3::183     3e-33  41%  197 aa  GCH1_CLOB8 RecName: Full=GTP cyclohydrolase 1;       
   20::206     2e-32  43%  215 aa  GCH1_SULTO RecName: Full=GTP cyclohydrolase 1;       
    9::178     4e-31  40%  188 aa  GCH1_CALMQ RecName: Full=GTP cyclohydrolase 1;       
   29::199     7e-31  44%  208 aa  GCH1_SULIN RecName: Full=GTP cyclohydrolase 1;       
   29::199     1e-30  44%  208 aa  GCH1_SULSO RecName: Full=GTP cyclohydrolase 1;       
   29::199     2e-30  44%  208 aa  GCH1_SULIY RecName: Full=GTP cyclohydrolase 1;       
   29::199     2e-30  44%  208 aa  GCH1_SULIM RecName: Full=GTP cyclohydrolase 1;       
   29::199     2e-30  44%  208 aa  GCH1_SULIL RecName: Full=GTP cyclohydrolase 1;       
   29::199     2e-30  44%  208 aa  GCH1_SULIK RecName: Full=GTP cyclohydrolase 1;       
   29::199     2e-30  44%  208 aa  GCH1_SULIA RecName: Full=GTP cyclohydrolase 1;       
   13::200     3e-30  41%  209 aa  GCH1_SULAC RecName: Full=GTP cyclohydrolase 1;       
   28::213     1e-29  36%  217 aa  GCH1_VIBCH RecName: Full=GTP cyclohydrolase 1;       
    6::196     7e-29  38%  196 aa  GCH1_CLOB6 RecName: Full=GTP cyclohydrolase 1;       
    6::196     1e-28  37%  196 aa  GCH1_CLOBL RecName: Full=GTP cyclohydrolase 1;       
    6::196     1e-28  37%  196 aa  GCH1_CLOBK RecName: Full=GTP cyclohydrolase 1;       
    6::196     1e-28  37%  196 aa  GCH1_CLOBH RecName: Full=GTP cyclohydrolase 1;       
    6::196     1e-28  37%  196 aa  GCH1_CLOB1 RecName: Full=GTP cyclohydrolase 1;       
    6::196     3e-28  37%  196 aa  GCH1_CLOBJ RecName: Full=GTP cyclohydrolase 1;       
    1::94      3e-28  57%   94 aa  GCH1_PHYBL RecName: Full=GTP cyclohydrolase 1;       
   18::218     4e-28  34%  218 aa  GCH1_HAEDU RecName: Full=GTP cyclohydrolase 1;       
   39::218     1e-27  40%  218 aa  GCH1_MANSM RecName: Full=GTP cyclohydrolase 1;       
   18::218     1e-27  34%  218 aa  GCH1_ACTPJ RecName: Full=GTP cyclohydrolase 1;       
   18::218     1e-27  34%  218 aa  GCH1_ACTP7 RecName: Full=GTP cyclohydrolase 1;       
   18::218     1e-27  34%  218 aa  GCH1_ACTP2 RecName: Full=GTP cyclohydrolase 1;       
   30::213     2e-27  37%  217 aa  GCH1_VIBHB RecName: Full=GTP cyclohydrolase 1;       
    6::196     2e-27  36%  196 aa  GCH1_CLOBM RecName: Full=GTP cyclohydrolase 1;       
   39::218     3e-27  40%  218 aa  GCH1_HAES2 RecName: Full=GTP cyclohydrolase 1;       
   39::218     3e-27  40%  218 aa  GCH1_HAES1 RecName: Full=GTP cyclohydrolase 1;       
   59::216     3e-27  42%  220 aa  GCH1_EDWI9 RecName: Full=GTP cyclohydrolase 1;       
   39::218     1e-26  36%  218 aa  GCH1_PASMU RecName: Full=GTP cyclohydrolase 1;       
   47::218     1e-26  39%  221 aa  GCH1_ERWT9 RecName: Full=GTP cyclohydrolase 1;       
   61::217     1e-26  42%  221 aa  GCH1_BLOFL RecName: Full=GTP cyclohydrolase 1;       
   36::213     1e-26  34%  216 aa  GCH1_TOLAT RecName: Full=GTP cyclohydrolase 1;       
   21::218     1e-26  35%  218 aa  GCH1_HAEIE RecName: Full=GTP cyclohydrolase 1;       
   21::218     1e-26  35%  218 aa  GCH1_HAEI8 RecName: Full=GTP cyclohydrolase 1;       
   18::214     5e-26  35%  216 aa  GCH1_WIGBR RecName: Full=GTP cyclohydrolase 1;       
   21::218     5e-26  35%  218 aa  GCH1_HAEIN RecName: Full=GTP cyclohydrolase 1;       
   21::218     1e-25  35%  218 aa  GCH1_HAEIG RecName: Full=GTP cyclohydrolase 1;       
   60::216     2e-25  38%  221 aa  GCH1_SERP5 RecName: Full=GTP cyclohydrolase 1;       
   60::216     2e-25  38%  220 aa  GCH1_PECCP RecName: Full=GTP cyclohydrolase 1;       
   60::216     2e-25  38%  220 aa  GCH1_ERWCT RecName: Full=GTP cyclohydrolase 1;       
   96::213     3e-25  45%  217 aa  GCH1_VIBPA RecName: Full=GTP cyclohydrolase 1;       
   61::213     3e-25  40%  217 aa  GCH1_SHEDO RecName: Full=GTP cyclohydrolase 1;       
   95::204     3e-25  47%  217 aa  GCH1_PHOPR RecName: Full=GTP cyclohydrolase 1;       
   62::213     5e-25  40%  217 aa  GCH1_VIBVY RecName: Full=GTP cyclohydrolase 1;       
   62::213     5e-25  40%  217 aa  GCH1_VIBVU RecName: Full=GTP cyclohydrolase 1;       
   60::217     1e-24  37%  221 aa  GCH1_SODGM RecName: Full=GTP cyclohydrolase 1;       
   35::212     1e-24  36%  214 aa  GCH1_SHELP RecName: Full=GTP cyclohydrolase 1;       
    3::179     1e-24  38%  187 aa  GCH1_PYRAE RecName: Full=GTP cyclohydrolase 1;       
   12::173     2e-24  38%  187 aa  GCH1_THENV RecName: Full=GTP cyclohydrolase 1;       
   42::212     8e-24  37%  216 aa  GCH1_SHESR RecName: Full=GTP cyclohydrolase 1;       
   42::212     8e-24  37%  216 aa  GCH1_SHESM RecName: Full=GTP cyclohydrolase 1;       
   42::212     8e-24  37%  216 aa  GCH1_SHESA RecName: Full=GTP cyclohydrolase 1;       
   38::212     1e-23  35%  214 aa  GCH1_SHESW RecName: Full=GTP cyclohydrolase 1;       
   38::212     1e-23  35%  214 aa  GCH1_SHEPC RecName: Full=GTP cyclohydrolase 1;       
    2::80      1e-23  57%   80 aa  GCH1_MUCHA RecName: Full=GTP cyclohydrolase 1;       
   95::213     2e-23  40%  217 aa  GCH1_ALISL RecName: Full=GTP cyclohydrolase 1;       
   32::216     3e-23  34%  221 aa  GCH1_BLOPB RecName: Full=GTP cyclohydrolase 1;       
   38::212     7e-23  35%  216 aa  GCH1_SHEON RecName: Full=GTP cyclohydrolase 1;       
   38::212     7e-23  35%  216 aa  GCH1_SHEB9 RecName: Full=GTP cyclohydrolase 1;       
   38::212     7e-23  35%  216 aa  GCH1_SHEB8 RecName: Full=GTP cyclohydrolase 1;       
   38::212     7e-23  35%  216 aa  GCH1_SHEB5 RecName: Full=GTP cyclohydrolase 1;       
   38::212     7e-23  35%  216 aa  GCH1_SHEB2 RecName: Full=GTP cyclohydrolase 1;       
   61::212     1e-22  39%  216 aa  GCH1_SHEAM RecName: Full=GTP cyclohydrolase 1;       
   95::213     2e-22  39%  217 aa  GCH1_VIBFM RecName: Full=GTP cyclohydrolase 1;       
   95::213     2e-22  39%  217 aa  GCH1_VIBF1 RecName: Full=GTP cyclohydrolase 1;       
   32::214     2e-22  34%  219 aa  GCH1_PHOLL RecName: Full=GTP cyclohydrolase 1;       
   28::206     2e-22  34%  206 aa  GCH1_CHRVO RecName: Full=GTP cyclohydrolase 1;       
   36::213     3e-22  34%  218 aa  GCH1_AERS4 RecName: Full=GTP cyclohydrolase 1;       
   36::213     3e-22  34%  218 aa  GCH1_AERHH RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_SHISS RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_SHIFL RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_SHIF8 RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_SHIDS RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_SHIBS RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_SHIB3 RecName: Full=GTP cyclohydrolase 1;       
   31::207     6e-22  32%  209 aa  GCH1_RALSO RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ESCF3 RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECOUT RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECOSM RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECOSE RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECOLU RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECOLI RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECOLC RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECOL6 RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECOL5 RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECOK1 RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECOHS RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECODH RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECOBW RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECO8A RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECO81 RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECO7I RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECO5E RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECO57 RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECO55 RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECO45 RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECO27 RecName: Full=GTP cyclohydrolase 1;       
   47::218     6e-22  35%  222 aa  GCH1_ECO24 RecName: Full=GTP cyclohydrolase 1;       
   99::217     8e-22  42%  220 aa  GCH1_HAMD5 RecName: Full=GTP cyclohydrolase 1;       
   52::216     2e-21  35%  220 aa  GCH1_YERPY RecName: Full=GTP cyclohydrolase 1;       
   52::216     2e-21  35%  220 aa  GCH1_YERPG RecName: Full=GTP cyclohydrolase 1;       
   52::216     2e-21  35%  220 aa  GCH1_YERPE RecName: Full=GTP cyclohydrolase 1;       
   52::216     2e-21  35%  220 aa  GCH1_YERPB RecName: Full=GTP cyclohydrolase 1;       
   52::216     2e-21  35%  220 aa  GCH1_YERP3 RecName: Full=GTP cyclohydrolase 1;       
   61::218     7e-21  32%  222 aa  GCH1_ENT38 RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALTY RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALTI RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALSV RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALPK RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALPC RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALPB RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALPA RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALNS RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALHS RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALEP RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALDC RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALCH RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALAR RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALA4 RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  35%  222 aa  GCH1_KLEP7 RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  35%  222 aa  GCH1_KLEP3 RecName: Full=GTP cyclohydrolase 1;       
   61::216     1e-20  36%  220 aa  GCH1_YERE8 RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  36%  222 aa  GCH1_SALG2 RecName: Full=GTP cyclohydrolase 1;       
   61::218     1e-20  32%  222 aa  GCH1_CITK8 RecName: Full=GTP cyclohydrolase 1;       
   96::219     2e-18  37%  220 aa  GCH1_BAUCH RecName: Full=GTP cyclohydrolase 1;       
   16::214     5e-18  30%  218 aa  GCH1_BUCAP RecName: Full=GTP cyclohydrolase 1;       
    2::64      5e-17  57%   80 aa  GCH1_EUGGR RecName: Full=GTP cyclohydrolase 1;       
    1::43      1e-05  44%   46 aa  GCH1_BACPU RecName: Full=GTP cyclohydrolase 1;       
   44::122     3e-04  30%  141 aa  QUEF_TRIEI RecName: Full=NADPH-dependent 7-cyano-7-deazaguanine
   61::165     6e-04  42%  408 aa  ACY1_MOUSE RecName: Full=Aminoacylase-1;       
  272::344     0.001  35%  490 aa  UBID_IDILO RecName: Full=3-octaprenyl-4-hydroxybenzoate
    1::202

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKLVEDTDSKILDTKKVSDKEAEEAFKTILTWMGEDPSREGLLETPKRVVKAFKEYFGGYTEDAEKILEK
GCH1_PELUB      MKLVEDTDSKILDTKKVSDKEAEEAFKTILTWMGEDPSREGLLETPKRVVKAFKEYFGGYTEDAEKILEK
GCH1_MARMM      ---------------KPSREEAEAAVRTLISWAGDDPTREGLLDTPKRVVKAYEEWFSGYDADPLKALGK
GCH1_BRUSU      --------------KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESPEEVLGT
GCH1_BRUSI      --------------KKPGKPEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESPEEVLGT
GCH1_BRUME      --------------KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESPEEVLGT
GCH1_BRUMB      --------------KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESPEEVLGT
GCH1_BRUC2      --------------KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESPEEVLGT
GCH1_BRUAB      --------------KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESPEEVLGT
GCH1_BRUA2      --------------KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESPEEVLGT
GCH1_BRUA1      --------------KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESPEEVLGT
GCH1_BRUO2      --------------KKPGKAEAEAAVRTLLLWVGEDPDREGLLETPKRVAKAYQELFGGYSGSPEEVLGT
GCH1_HYPNA      --------------RRPSQQEAEEAVRTLIAWAGDDPAREGLIDTPKRVVNAYKEWFEGYGEDPVKYLSR
GCH1_CAUCR      --LIGSDDTTGLDLEPVSKDEAMAAVRTLLAWAGDNPEREGLIDTPKRVVEAFDEWFAGYHGDPAKELSR
GCH1_BARQU      --------------KRPHFEEVEAAIRTLLLWIGENPNREGLLDTPRRVAKAYRDLFIGYGESVEEILGT
GCH1_SINMW      -----------------TQKEAEEAVRVLLRWAGEDPAREGLKDTPARVAKAYREIFGGYDLAAEDVLGR
GCH1_XYLFM      ----------------ITQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDPHDYLQR
GCH1_BARHE      --------------KRPPFEEVEAAIRTFLLWIGENPNREGLLDTPGRVAKAYRDLFTGYDESVEEILGT
GCH1_XYLFA      ----------------ITQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDPHDYLQR
GCH1_XANCP      ----------------VTQAQAEEAVRTLLRWAGEDPAREGLLDTPRRVAEAYGDWFSGYREEPRAYLER
GCH1_RHISN      --LLDDTSGR------PTQKEAEEAVRVLLRWAGEDPTREGLKDTPARVIKSYREIFGGYDLVAEDVLGR
GCH1_XYLFT      ----------------ITQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDPHDYLQR
GCH1_XYLF2      ----------------ITQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDPHDYLQR
GCH1_XANC5      ----------------VTQTQAEEAVRTLLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYREEPREYLER
GCH1_XANAC      ----------------VTQTQAEEAVRTLLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYRDEPREYLER
GCH1_RHILO      -------------TDRPSEAEVEAAVRTLLRWTGDNPDREGLIDTPKRVAKAFREMFGGYDMCPAEELGR
GCH1_RHIME      ------------DTGRPTQKEAEEAVRVLLRWAGEDPAREGLKDTPSRVAKAYREIFGGYDLVAEDVLGR
GCH1_OCHA4      ---------------KPTQADAEAAVRTLLLWAGDDPEREGLLETPKRVAKAYKELFAGYTESPEEVLGT
GCH1_RHOPT      ------------DQPRPSRAEAEAAVKTLLSYIGENTEREGLIDTPRRVVEAYDELFQGYHQCPKEVLER
GCH1_RHOPA      ------------DQPRPSRAEAEAAVKTLLSYIGENTEREGLIDTPRRVVEAYDELFQGYHQCPKEVLER
GCH1_BARBK      -----------------------KAIRTLLLWVGENPDREGLLETPKRIAKVYKELFSGYGESVDEILGV
GCH1_METS4      -------------TERPTRQEAEAAVRTLIRWAGDDPEREGLRETPQRVARAYEQIFGGYRQEPTHILDR
GCH1_RHOP2      ------------DQPRPSRAEAEAAVKTLLSYIGENTEREGLLDTPRRVVEAYDELFQGYHQCPAEVLDR
GCH1_RHOPS      ------------DQPRPSRTEAEQAVKTLLAYIGENTGREGLLDTPRRVVEAYDELFQGYHQCPAEVLDR
GCH1_RHOPB      ------------DQPRPSRGEAEQAVKTLLAYIGEDTAREGLLDTPRRVVEAYDELFQGYHQCPAEVLNR
GCH1_AGRVS      ------------ETSRPSREEAENAVRTLLRWAGDDPSREGLLDTPKRVAKAYGELFGGYNVNVEDVLGT
GCH1_AGRT5      -----------------SQAEAEEAVRVLLRWAGENPAREGLLDTPKRVAKAYRELFAGYELNVQDVLGT
GCH1_AZOC5      --------------------------RTLLAYIGEDPHREGLQETPARVIRSYDEIYGGYALSPDDVLDR
GCH1_THEEB      ---------------EVAKEEMMAAVRTILLNVGEDPDREGLLKTPKRVAEAMQFLTSGYSQSLETLVNG
GCH1_BEII9      -------------------------------WTGDDPSREGLRDTPKRVVKAFEEFFSGYNADASDVLSR
GCH1_SYNP6      ------------ETEAVSQAEMEAAVRTLLLGVGEDPEREGLLKTPKRVAEAYRFLTSGYSQSLDDLVNG
GCH1_SYNE7      ------------ETEAVSQAEMEAAVRTLLLGVGEDPEREGLLKTPKRVAEAYRFLTSGYSQSLDDLVNG
GCH1_MESSB      -------------TDRPSREEAEAAVRTLLRWAGDNPDREGLKETPARVVKAYQELFGGYDLCPAEELGR
GCH1_BRAJA      --------------------------KTLLAYIGENTEREGLLDTPRRVVEAFDELYQGYHQCPAEVLDR
GCH1_SYNJB      -----------LGSSDVSDPAMVAAVETLLRGIGEDPQREGLRKTPERVVAALKFLTSGYRQSLEELLNS
GCH1_RICBR      --------------KKPTKEEAKEAVRTLLRFIGEDPNREGLFKTPDRVIKSYEEIFSGYGKNIEEILET
GCH1_RICB8      --------------KKPTKEEAKEAVRTLLRFIGEDPNREGLFKTPDRVIKSYEEIFSGYGKNIEEILET
GCH1_RICTY      ---------------KPTREEAKEAVRTLLRFIGEDPTREGLLKTPDRVINSYMEIFSGYGKDVQEILNT
GCH1_NOSP7      ----------VFPPKEEHIEEMKDAVRKIILGVGEDPEREGLLKTPKRVAEAMRFLTSGYNQSLEELVND
GCH11_ANASP     ------------------------AVRSILVGVGEDPEREGLLKTPKRVAEAMRFLTSGYNQSLEELLNG
GCH1_SYNJA      ------------------------AVETLLRGIGEDPQREGLKKTPERVVAALKFLTSGYRQSLEDLING
GCH1_CHLTE      -----------------------DAVYSLLKGVGEDPEREGLLLTPERVAKSLRFLTKGYRQDPEQLLKK
GCH1_CHLCH      ----------------------ESAVYTMLQNVGEDPQREGLLKTPERVARSMRFLTKGYHENPEELLQK
GCH1_FINM2      ------------------DKEKEQAVSMIIEAIGEDPNREGLLETPQRVARMYEEIFSGLNQDAKTHLSK
GCH1_SYNY3      ---------------ELNKEKMMDAVRVMLESVGEDPEREGLLKTPKRVAEAMQFLTQGYDQSLEKLVNG
GCH1_RICPR      ---------------KPTREEAKEAVRTLLKFIGEDPNREGLLKTPDRVINSYTEIFSGYGKDAQEILNT
GCH1_CLOPE      ------------------DKEKKEGMKLILEAIGEDVNREGLIETPDRIARMYEEIFSGIGMNAKEHLSK
GCH1_PROVI      -----------------------ESVYTLLEGVGEDPEREGLLKTPERVARSLAFLTRGYRQDPEEMLKK
GCH1_CLOPS      ----------------IDKDKIREGMKLILEAIGEDANREGLIETPDRIARMYEEIFSGIGMNAKEHLSK
GCH1_GLOVI      -----------------------DAVRTLLVGVGEDPERNGLERTPKRVAEALKFLTKGYGQSLEELLNG
GCH1_CLOP1      ----------------IDKDKIREGMKLILEAIGEDINREGLIETPDRIARMYEEIFSGIGMNAKEHLSK
GCH1_RICFE      ---------------KPTREEAKEAVRTLLKFIGEDPTREGLLKTPDRVVNSYTEIFSGYGKDVAEILNT
GCH1_CAEEL      ------------------------AYQSIIQHVGEDINRQGLLKTPERAAKAMMAFTKGYDDQLDELLNE
GCH1_CAMJ8      -------------------KKFEDCVKTILEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQNVKEILND
GCH1_CAMJR      -------------------KKFEDCVKTILEIIGENPNREGLIKTPNRVFKAYEFLASGYTQNVKDILND
GCH1_RICAH      ---------------KPTREEATEAVRTLLKFIGEDPTREGLLKTPDRVINSYTEIFSGYGKDVEEILNT
GCH12_ANASP     -------------TPTVTEAEMVQAVRTLLIGLGENPDREGLLDTPKRVVKALQFLTKGYNESLDELLNG
GCH1_CAMJE      -------------------KKFEDCVKTMLEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQNVKEILND
GCH1_CAMJD      -------------------KKFEDCVKTMLEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQNVKEILND
GCH1_CORGL      --------------REFDEERATAAIRELLIAVGEDPDREGLLETPARVARAYKETFAGLHEDPTTVLEK
GCH1_COXBU      --------------------------KAILIALGEDPNREGLRDTPKRYEKALEHLTKGYHEKLPSVVKK
GCH1_COXBR      --------------------------KAILIALGEDPNREGLRDTPKRYEKALEHLTKGYHEKLPSVVKK
GCH1_COXBN      --------------------------KAILIALGEDPNREGLRDTPKRYEKALEHLTKGYHEKLPSVVKK
GCH1_CLOK5      ----------------MDENKIKDAVRMIIEAIGENPEREGLAETPDRIARMYTEIFSGLKEKPEEHLKK
GCH1_CLOK1      ----------------MDENKIKDAVRMIIEAIGENPEREGLAETPDRIARMYTEIFSGLKEKPEEHLKK
GCH1_CAMJJ      -------------------KKFEDCVKTMLEIIGENPNREGLIKTPNRVFKTYEFLTSGYTQNVKEILND
GCH1_BACA2      --------------KEVNKEQIEQAVRQILEAIGEDPDREGLLDTPKRVAKMYAEVFSGLNEDPKEHFKT
GCH1_BACSU      --------------KEVNKEQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFSGLNEDPKEHFQT
GCH1_CORGB      --------------REFDEERATAAIRELLIAVGEDPDREGLLETPARVARAYKETFAGLHEDPTTVLEK
GCH1_CHICK      ------------------------AYTTILRALGEDPERQGLLKTPWRAATAMQFFTKGYQETIADVLND
GCH1_RAT        ------------------------AYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLND
GCH1_RICPU      ---------------KPTREEAKEAVRTLLKFIGEDPSREGLLKTPDRVINSYAEIFSGYGKDVAEILNT
GCH1_RICM5      ---------------KPTREEAKEAVRTLLKFIGEDPSREGLLKTPDRVINSYAEIFSGYGKDVAKILNT
GCH1_WOLSU      -----------MEDKKIA---MEETIRSIFDFIGDDRHREGLLDTPKRVVKSWDKLYSGYTQDPREILGT
GCH1_DICDI      ----------------------QSSVKTLLSSLGEDPDREGLLKTPLRMSKALLFFTQGYEQSVDEVIGE
GCH1_SCHPO      ----QGTQRRIDTAEEEKVKKISNAISTILECLGEDPERQGLLGTPERYAKAMLYFTKGYEQNLTEVINE
GCH1_RICAE      ---------------KPTREEATEAVRTLLKFIGEDPSREGLLQTPDRVINSYVEIFSGYGKDVAEILNT
GCH1_STRSY      -------------------EQIEQTIYQLLELLGEDPNREGLLDTPKRVAKMYLEMFNGLEEDPKDQFTA
GCH1_STRS2      -------------------EQIEQTIYQLLELLGEDPNREGLLDTPKRVAKMYLEMFNGLEEDPKDQFTA
GCH1_RICRS      ---------------KPTREEAKEAVRTLLKFIGEDPSREGLLKTPDRVINSYAEIFSGYGKDVAEILNT
GCH1_RICRO      ---------------KPTREEAKEAVRTLLKFIGEDPSREGLLKTPDRVINSYAEIFSGYGKDVAEILNT
GCH1_RICCN      ---------------KPTREEAKEAVRTLLKFIGEDPSREGLLQTPDRVINSYVEIFSGYGKDVAEILNT
GCH1_STRAW      ------TDPVTLDGEEFDEKRAENAVRELLIAVGEDPDREGLRETPGRVARAYREIFAGLWQKPEDVLTT
GCH1_BACAH      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_STRPN      -----------MDTQKI-----EAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSK
GCH1_STRPJ      -----------MDTQKI-----EAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSK
GCH1_STRP7      -----------MDTQKI-----EAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSK
GCH1_STRP4      -----------MDTQKI-----EAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSK
GCH1_STRR6      -----------MDTQKI-----EAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSK
GCH1_STRP2      -----------MDTQKI-----EAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSK
GCH1_CAMC5      ----------------------ENSVKNILKIIGEDPNREGLLKTPSRVYKAFKFLTSGYEEDPKEVLND
GCH1_AZOVD      ----------------------EQQYTAILAQLGEDVSREGLVDTPKRAAKAMQYLCRGYQQTLEEVVNG
GCH1_PORGI      --------------KEEACSRLQQHYAQVLSLLGEDPKREGLLKTPLRVAKAMQFLTKGYNEDPEAILRA
GCH1_PORG3      --------------KEEACSRLQQHYAQVLSLLGEDPKREGLLKTPLRVAKAMQFLTKGYNEDPEAILRA
GCH1_LEPIN      ----------------------EEDVINILKSIGEDPTREGLLNTPKRVKKAYEFLTSGYRADITKIVNG
GCH1_LEPIC      ----------------------EEDVINILKSIGEDPTREGLLNTPKRVKKAYEFLTSGYRADITKIVNG
GCH1_LEPBL      ----------------------EENIVNILKSIGEDPTREGLLNTPKRVKKAYDFLTSGYHVDITKVVNG
GCH1_LEPBJ      ----------------------EENIVNILKSIGEDPTREGLLNTPKRVKKAYDFLTSGYHVDITKVVNG
GCH1_STRMU      -----------MNEKIMSDKKIEEAVYQLLEALGEDPNREGLLDTPKRVAKMYQEMFAGLNEDPKDQFTA
GCH1_STRCO      ------TDPVTLDGEEFDEKRAENAVRELLIAVGEDPDREGLRETPARVARAYREIFAGLWQEPEDVLTT
GCH1_MYCVP      --------SATITTARFDQARAEAAVRELLIAVGEDPDREGLRDTPARVARAYQEIFAGLYTDPDEVLKT
GCH1_MYCGI      --------SATLTTPDFDQARAEAAVRELLIAVGEDPDREGLLDTPARVARSYREIFAGLYTDPDEVLTT
GCH1_MOUSE      ---------------------------------GEDPQRQGLLKTPWRAATAMQYFTKGYQETISDVLND
GCH12_PSEAE     ----------------------EQHYSSILTQLGEDVNREGLLDTPKRAAKAMKYLCRGYQQSLEEVVNG
GCH1_STRPY      ----------------INKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFAGLKKDPKEEFTA
GCH1_CARHZ      ----------------VDKEKIEIAVRMILEAIGEDPDREGLKDTPKRVARMYEEVFAGLSQDPSEHLER
GCH1_BACWK      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_BACHK      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_BACCZ      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_BACCR      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_BACCQ      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_BACC7      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_BACC4      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_BACC3      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_BACC2      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_BACC1      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_BACC0      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_BACAN      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_BACAC      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH1_BACAA      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHK
GCH12_PSEPK     -----------------------EHYHEILVGIGENPQREGLLDTPRRAAKAMQYLCNGYAQDLHEVVNG
GCH1_THEFY      ---VGDTDAGLAPAG-IDQPRIEKAVREILLAIGEDPDRDGLVETPARVARAFAEQFAGLSQRPEDVLTT
GCH1_STRZP      -----------MDTQKI-----EAAVKMIIEAVGENANREGLQETPARVARMYQEIFSGLGQTAEEHLSK
GCH1_STRZJ      -----------MDTQKI-----EAAVKMIIEAVGENANREGLQETPARVARMYQEIFSGLGQTAEEHLSK
GCH1_STRPS      -----------MDTQKI-----EAAVKMIIEAVGENANREGLQETPARVARMYQEIFSGLGQTAEEHLSK
GCH1_STRPI      -----------MDTQKI-----EAAVKMIIEAVGENANREGLQETPARVARMYQEIFSGLGQTAEEHLSK
GCH1_STRZT      -----------MDTQKI-----EAAVKMIIEAVGENVNREGLQETPARVARMYQEIFSGLGQTAEEHLSK
GCH1_METCA      ----------------------ETLFSQLIQEIGEDVSREGLVDTPKRAASAFRFLNSGYHQSLDHVLNN
GCH1_BACP2      ---------------EINKELIEHAVRDILKAIGEDPDREGLLDTPKRVAKMYEEVFSGLNEDPKEHFKT
GCH1_ALHEH      ----------------------EAAYRRILQDLGEDPDREGLKDTPARAAKAMRFLTKGYQEDLDQVLNG
GCH1_STRGG      ------------------EKRAEAAVRELLIAVGEDPDREGLRETPGRVARAYKEIFAGLYQEPEDVLTT
GCH1_BACCN      ---------------KVNLEQIEHAVRLILEAIGDDPNREGVLDTPRRVAKMYAEVFSGMHEDPKEHLHK
GCH1_PARD8      -------------------------YKEVLGLLGEDVEREGLLKTPERVAKAMQFLTKGYHEDPEAVLRS
GCH1_JANMA      ------------------DDFSTEDWRRLLTHLGENADRQGLRETPQRVEKAWKHWTSGYDQDPAEILKV
GCH1_COREF      ---------KLGAVREFDQERAEAAVRELLIAVGENPEREGLLETPARVARAYREIFAGLHEDPTAVLNK
GCH1_STRA5      -----------------NQEKMEKAIYQFLEALGENPNREGLKDTPKRVAKMYIEMFSGLNQDPKEQFTA
GCH1_RHOBA      ----------------------ESAVREILEAVGEDPDRDGLLETPERVARMYAEMFAGLKSDPGRHLAK
GCH1_CAMLR      ----------------------EQSVKNMLEIIGENPQREGLLKTPTRVFKAFEFLNSGYKQDPKQILND
GCH1_STRA1      -----------------NQEKMEKAIYQFLEALGENPDREGLKDTPKRVAKMYIEMFSGLNQDPKEQFTA
GCH1_HUMAN      ---------------------------------GENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLND
GCH1_DESRM      ----------------------EKAVKMILEAIGEDPNREGLEETPARVARMYQEIFAGLGEDPEEHLGK
GCH1_OSTOS      ----EDCDQKIIASKKTSNLDKTAAYSSIISHVGEDVNRQGLLKTPDRAAKAMLYFTKGYEQQLDDILND
GCH1_CAMC1      ----------------------ENSVKNMLTIIGEDPNREGLIKTPERVYKAFKFLTSGYEQDPKEVL--
GCH1_LEPBP      ----------------------ENLIEEILKQIGEDPNREGLVKTPNRVKKAYDFLTSGYKADINQLVNG
GCH1_LEPBA      ----------------------ENLIEEILKQIGEDPNREGLVKTPNRVKKAYDFLTSGYKADINQLVNG
GCH11_PSEAE     -------------------------YREILVGLGEDPQREGLLDTPKRAAKAMQYLCHGYGQTLEEIVNG
GCH1_STRPG      ----------------INKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTA
GCH1_STRP8      ----------------INKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTA
GCH1_STRP6      ----------------INKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTA
GCH1_STRP3      ----------------INKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTA
GCH1_STRP1      ----------------INKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTA
GCH1_MYCA9      ---------------------AEAAVRELLYAVGEDPDRHGLADTPARVARAYREIFAGLYTDPDTVLNT
GCH1_STRPZ      ----------------INKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTA
GCH1_STRA3      -----------------NQEKMEKAIYQFLEALGENPDREGLKDTPKRVAKMYIEMFSGLNQDPKEQFTA
GCH1_PELTS      ----------------------EKAVRLILEAIGENPEREGLKGTPARVARMYEEIFSGLQEDPEEHLQK
GCH1_CORA7      --------------REFDHERAEAAVRELLIAVGEDPDREGLRETPARVARAYAEVFAGLHQDPTEVLHK
GCH1_LYSSC      ----------------------EEAVKMILEAVGEDVNREGLLDTPKRVAKMYAEMFSGLHEDAKDYFRT
GCH1_BREBN      ----------------------QQAVRMILEAVGDDPDREGVLDTPKRVAKMYAEVFEGMHIDEEQYFET
GCH1_THEPX      ------------------DKEKKKAVRDILEAIGEDPDREGLLETPDRVARMYEEIFAGLHTDVKDVI-K
GCH1_THEP3      ------------------DKEKKKAVRDILEAIGEDPDREGLLETPDRVARMYEEIFAGLHTDVKDVI-K
GCH1_STRT2      -----------------NQEKVEQAVYQLLEALGENPEREGLLDTPKRVAKMYAEMFSGLNEDPKDQFTA
GCH1_STRT1      -----------------NQEKVEQAVYQLLEALGENPEREGLLDTPKRVAKMYAEMFSGLNEDPKDQFTA
GCH1_GEOSW      ----------------VNYEQIEYAVRLILEAIGEDPNREGLVDTPKRVAKMYAEVFAGLHEDPKQHFQT
GCH1_BACHD      ---------------KVDHEKIQQAVVMILEAIGEDPAREGLEDTPKRVAKMYEEVFAGLNQDPKEHFAT
GCH1_BACFR      -------------------EDLKNHYRSIITLLGEDAEREGLLKTPERVAKAMLTLTKGYHMDPHEVLRS
GCH1_BACFN      -------------------EDLKNHYRSIITLLGEDAEREGLLKTPERVAKAMLTLTKGYHMDPHEVLRS
GCH1_THETN      ------------------DKEKKKAVREILEAIGEDPDREGLLETPDRVARMYEEIFSGLHTDVKDVI-K
GCH1_YEAST      ------------------------AIKTILTELGEDVNREGLLDTPQRYAKAMLYFTKGYQTNIMDDVIK
GCH1_GEOKA      ---------------EINFAQIEYAVRLILEAIGEDPNREGLVDTPKRVAKMYAEVFAGLQEDPKQHFQT
GCH1_BACTN      -------------------EELKSHYHSIITLLGEDAGREGLLKTPERVAKAMLSLTKGYHMDPHEVLRS
GCH1_DEHSC      ------------------EQAIKQSVQNILVAIGEDPDREGLKETPRRVAQMYTELFSGMNQDPAEVLR-
GCH1_DEHSB      ------------------EQAIKQSVQNILVAIGEDPDREGLKETPRRVAQMYTELFSGMNQDPAEVLR-
GCH1_CLOD6      ---------------KVDKEKIQHAVREILEAIGEDPDREGLIETPNRVARMYEEIFSGLSEEPRDHLKV
GCH1_STRGC      -------------------EKLQETVYQLLELVGENPDREGLLDTPKRVAKMYQEVFSGLGRDPKDEFTA
GCH1_CHRSD      -------------------EELADNYRHIIAGLGEDPDREGLRDTPKRAAKAMQFLTQGYGQTLESLVNG
GCH1_NEUCR      ------------------------AVRTLLECIGEDPDREGLLATPERYAKAMLFLTKGYQENVRDIVNG
GCH1_MYCTU      -----DSRSASARIRVFDQQRAEAAVRELLYAIGEDPDRDGLVATPSRVARSYREMFAGLYTDPDSVLNT
GCH1_MYCTA      -----DSRSASARIRVFDQQRAEAAVRELLYAIGEDPDRDGLVATPSRVARSYREMFAGLYTDPDSVLNT
GCH1_MYCBT      -----DSRSASARIRVFDQQRAEAAVRELLYAIGEDPDRDGLVATPSRVARSYREMFAGLYTDPDSVLNT
GCH1_MYCBP      -----DSRSASARIRVFDQQRAEAAVRELLYAIGEDPDRDGLVATPSRVARSYREMFAGLYTDPDSVLNT
GCH1_MYCBO      -----DSRSASARIRVFDQQRAEAAVRELLYAIGEDPDRDGLVATPSRVARSYREMFAGLYTDPDSVLNT
GCH1_DEHE1      ------------------EQAIKQSVQNMLLAIGEDPEREGLKETPRRVAQMYAELFSGMNQDPAEVLR-
GCH1_MYCLE      -------------------QRAEAAIRELLYAIGEDPDREGLADTPARVARACRELFSGLYTDPQTVLNT
GCH1_MYCLB      -------------------QRAEAAIRELLYAIGEDPDREGLADTPARVARACRELFSGLYTDPQTVLNT
GCH1_CLOTH      ------------------DKERKAAVRELLIGIGEDPDREGLLETPDRVARMCEEIFAGLHQDPKSVV-K
GCH1_SULSY      ----------------IDKNKIEQAIRLFLEGIGEDPNREGLRDTPKRVAKMWEEF-----ESYREMNMT
GCH1_PERMH      ----------------IDREKLKRSIRLFLEAIGEDPDREGLKETPDRIVRLWEEF-----KSYENFNMT
GCH1_NITMU      -------------------------WQRLLRSLGEDPSRQGLRETPERVTRAWAHWTRGYKQDPAAIL-K
GCH1_MYCPA      -------DTATHQVRQFDQARAEAAVRELLFAIGEDPDRHGLAETPARVARAYREMFAGLYTDPDSVLNT
GCH1_LISW6      -----------IDKQKIAD-----AVKVILEAVGENPEREGLIDTPMRVARMYEEVFSGLKKDPSIHFDT
GCH11_PSESM     -------------------------YRDILLELGENPEREGLLDTPKRASKAMQYLCHGYTQTVEEIVNG
GCH1_THEYD      -------------------KKIEEGVRLILEGIGEDVERPGIKDTPIRIARMFEEIFRGLLPPDEDLLKS
GCH1_MYCA1      -------DTATHQVRQFDQARAEAAVRELLFAIGENPDRHGLAETPARVARAYREMFAGLYTDPDSVLNT
GCH1_LISMO      -----------IDKQKIAD-----AVKVILEAVGENPDREGLIDTPMRVARMYEEVFAGLKKDPSVHFDT
GCH1_LISMH      -----------IDKQKIAD-----AVKVILEAVGENPDREGLIDTPMRVARMYEEVFAGLKKDPSVHFDT
GCH1_LISMF      -----------IDKQKIAD-----AVKVILEAVGENPEREGLIDTPMRVARMYEEVFAGLKKDPSVHFDT
GCH1_LISMC      -----------IDKQKIAD-----AVKVILEAVGENPEREGLIDTPMRVARMYEEVFAGLKKDPSVHFDT
GCH1_LISIN      -----------IDKQKIAD-----AVKVILEAVGENPEREGLIDTPMRVARMYEEVFAGLKKDPSVHFDT
GCH1_BIFLD      --------------KRTYDEEGREAVRLFLKSIGEDPGREGLVETPDRIARACRELFAGLQASPADVLEK
GCH1_PSEA6      -------------------------YSQILSILGEDTQRGGLVDTPKRAAKAMQFLTDGYEKNLNDVVNG
GCH1_STRSV      ---------------------------------GEDGSREGLQETPQRIAKMYQEIFAGLGETAEEHLAK
GCH1_DEIRA      -----------------------------LAAIGEDPDREGLQRTPQRVAKAWAYMTEGYGQTLAQVVGE
GCH1_CLONN      -------------------EKIKKAVIMIIEAIGEDPNREGLKETPDRIARMYEEIFSGIRETPEKHL--
GCH1_ONCMY      -------------TRSIEDNEMSAAYTTIIRGLGKDPQRQGLLKTPWRAATAMQFFTKGYQEKIIDVLND
GCH1_PSEHT      --------------------ELKQGYENIITAVGEDPNREGLLDTPKRAAKAMEYLTQGYRQTLEEITNN
GCH1_HELPY      ----------------------ENFFNQFFESIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKS
GCH1_HELP2      ----------------------ENFFNQFFENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPKVALKS
GCH1_BIFLO      --------------KHTYDEEGREAVRLFLKSIGEDPEREGLVETPDRIARACRELFTGLQASPADALEK
GCH1_AQUAE      ------------------DKEKKQAVRLFLEGIGEDPDREGLKETPERVARMWEEF-----ERMRNFDMK
GCH1_HELPJ      ----------------------EKFFNQFFENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKS
GCH1_HELPG      ----------------------ENFFNQFFENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPKVALKS
GCH1_HAHCH      -------------------------YSAIIESLGEDVNREGLRDTPKRAAKAMQFLCRGYNQSLEEVTNG
GCH12_PSESM     ----------------------EQNYTAILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYAQTLEEVTNG
GCH1_MYCUA      --------------------------------IGEDPDRGGLRDTPARVARAYREIFAGLYTDPDAVLNT
GCH1_MYCMM      --------------------------------IGEDPDRGGLRDTPARVARAYREIFAGLYTDPDAVLNT
FOLKE_LACLA     ---VSEQELHVIKEEKTPRNRIEDAVKEILFAVGENPNREGLLETPARVAKMYEEILS--SQRLSKFNEY
GCH1_HELPS      ----------------------ENFFNQFFENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPKVALKS
GCH1_FLAJ1      --------------------------ENILQTLGMDLTDDSIKGTPNRVAKMFKEIFGGLNP-AKQPKAS
GCH1_HELPH      ----------------------ENFFNQFFENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKS
FOLKE_LACLM     ----------VIEEEKSPKNRIEEAVKEILFAVGENPNREGLLETPARVAKMYEEILSSQRLTNFNEYKL
GCH1_TERTT      -----------------------ELYANLISSTGEDLQRPGLQGTPARAATAFEYLTSGYKQSVQEVVND
GCH1_LACPL      ----------------------EHAVREILSAVGEDPDRPGLVETPARVARMYAEVFA--TKTAAPFDNY
GCH11_PSEPK     ----------------------EQNYTEILSQIGEDVSREGLLDTPKRAAKAMKYLCRGYEQTLEEVTNN
GCH1_DROME      -------------TREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLNG
GCH1_CLOAB      ----------------IDTKAIEKHIRGILIALGDDPDREGLKETPKRVAKMYEEVFKGMNDDIAEMFNK
GCH1_HYDS0      -----------------------EGIKLFLEGIGEDITREGIKETPERVAKMWEEF-----EKERSFDFK
GCH1_HELAH      ----------------------ENFFNQFFENIGEDKNREGLKNTPKRVQELWNFLYKGYKEDPKVALKS
GCH1_HYPBU      ----------------IDKAKIEKAVRMILEAIGEDPEREGLRETPRRVADMFEELLEGYTEEYTWFTEA
GCH1_ENTFA      --------------------QIEQAVTTILEAVGEDTQRAGLIDTPKRVAKMYAEVFSGLTEPE------
GCH1_FUSNN      --------------EKMDSKRIENAFFEVIEALGDVEYKEELKDTPKRIADSYKEIFYGIDIDPKEVLTK
GCH1_LEIXX      ---------------------------------GEDPSRPGLSATPSRVADAYAEFFAGLGRDAEAELGE
GCH1_LACSS      -----------------ANQQIEKDVRDILKQVGDDPERAGVLETPQRVAKMYGEVLAYQGETIFKDYKL
GCH1_HELHP      ---------------------AQAFFESLCQNVGENPTREGLLHTPKRIASAFSDMLNGYAKSPKQALGS
GCH1_CLOCE      ----------------IDRKKVEEHIRGLLVAIGENPDREGLKETPSRVAQMYQEVFEGYTNDEAEMFNK
GCH1_CLOB8      --------------KKIDTKKIEECIREIIVALGDDPNREGLLDTPKRVSKMYEEVFQGMTLSNREIAE-
GCH1_SULTO      -------------------EEIAKRIREILEILGENPDREGLRETPLRVARALLEMTSGLRTPQPQI--K
GCH1_CALMQ      ----------------------KQAVKQILVAIGEDPEREGLRRTPDRVANMLEELTNGREENVQYTL--
GCH1_SULIN      -----------------------------------NPEREGLKETPERVAKALLEMTSGLRTPPPQIKVF
GCH1_SULSO      -----------------------------------NPEREGLKETPERVAKALLEMTSGLRTPPPQIKVF
GCH1_SULIY      -----------------------------------NPEREGLKETPERVAKALLEMTSGLRTPPPQIKVF
GCH1_SULIM      -----------------------------------NPEREGLKETPERVAKALLEMTSGLRTPPPQIKVF
GCH1_SULIL      -----------------------------------NPEREGLKETPERVAKALLEMTSGLRTPPPQIKVF
GCH1_SULIK      -----------------------------------NPEREGLKETPERVAKALLEMTSGLRTPPPQIKVF
GCH1_SULIA      -----------------------------------NPEREGLKETPERVAKALLEMTSGLRTPPPQIKVF
GCH1_SULAC      -------------------EEIAKRVKEILQLIGEDTEREGLKETPERVAKALLEMTSALRSPQPYIKVF
GCH1_VIBCH      -----------LATPAEKKEKIEQHMREILNLLGLDLTDDSLEETPQRIAKMYVDEIFSGLDYANFPKIT
GCH1_CLOB6      -------------------KAIEEHIKGILIALGDNPEREGLKDTPKRVAKMYEEVFKGYTNDEAEMFNV
GCH1_CLOBL      -------------------KAIEEHIRGILIALGDNPEREGLKNTPKRVAKMYEEVFKGMCYSNDEIAEM
GCH1_CLOBK      -------------------KAIEEHIRGILIALGDNPEREGLKNTPKRVAKMYEEVFKGMCYSNDEIAEM
GCH1_CLOBH      -------------------KAIEEHIRGILIALGDNPEREGLKNTPKRVAKMYEEVFKGMCYSNDEIAEM
GCH1_CLOB1      -------------------KAIEEHIRGILIALGDNPEREGLKNTPKRVAKMYEEVFKGMCYSNDEIAEM
GCH1_CLOBJ      -------------------KAIEEHIRGILIALGDDPEREGLKNTPKRVAKMYEEVFKGMCYSNDEIAEM
GCH1_PHYBL      ----------------------------------------------------------------------
GCH1_HAEDU      -KGIETPTIELTQDKDSRRAEIQQHMRSVLELLGLDLRDDSLEETPHRLAKMYVDEIFSGLDYATFPKIT
GCH1_MANSM      ----------------------ENRMREVMQLIGLDLTDDSLEETPVRLAKMFDEIFSGYTNFPK-----
GCH1_ACTPJ      -KGIETPTVQLTKDKDSRRAEIQQHMRSVLELLGLDLQDDSLEETPHRLAKMYDEIFSGLDYATFPKITN
GCH1_ACTP7      -KGIETPTVQLTKDKDSRRAEIQQHMRSVLELLGLDLQDDSLEETPHRLAKMYDEIFSGLDYATFPKITN
GCH1_ACTP2      -KGIETPTVQLTKDKDSRRAEIQQHMRSVLELLGLDLQDDSLEETPHRLAKMYDEIFSGLDYATFPKITN
GCH1_VIBHB      -------------SREEKKEKIEHHMREILGLLQLDLTDDSLEETPHRIAKMYDEIFSGLDSNFPKIT--
GCH1_CLOBM      -------------------KAIEEHIRGILIALGDNPEREGLKDTPKRVAKMYEEVFKGMCYSNDEIAEM
GCH1_HAES2      ----------------------EQHMREVIKLIGLDLSDDSLEETPARLSKMFDEIFSGL--DYANFPKI
GCH1_HAES1      ----------------------EQHMREVIKLIGLDLSDDSLEETPARLSKMFDEIFSGL--DYANFPKI
GCH1_EDWI9      ------------------------------------------VETPSRIAKMYDEIFSGYANFPKITIIE
GCH1_PASMU      ----------------------EQHMREVMKLIGLDLRDDSLEETPVRLAKMFVDEIFSGLDYANFPKIT
GCH1_ERWT9      ----------------------------IMQLLNLDLEDDSLAETPQRIAKMYNEVFSGLDANFPKIT--
GCH1_BLOFL      --------------------------------------------TPKRVAKMYEEIFSGLDYNFPKIT--
GCH1_TOLAT      -------------------QQIEQHMTSIMTXXXXXXXXXXXXETPHRIAKMYDEIFSGLDYGSFPKITL
GCH1_HAEIE      -------ETPMIDPTQAKDERRESIAKEVMKLIGLDLRDDSLEETPNRLAKMFDEIFSGMDYANFPKMTK
GCH1_HAEI8      -------ETPMIDPTQAKDERRESIAKEVMKLIGLDLRDDSLEETPNRLAKMFDEIFSGMDYANFPKMTK
GCH1_WIGBR      -KGIETPFKKIYEKNKPDIHKISKYIKKIMXXXXXXXXXXXXXKTPNRIAYMYEEIFSGYNNFPKITLIK
GCH1_HAEIN      -------ETPMIDPTQAKNERRESIAKEVMKLIGLDLRDDSLEETPNRLAKMFDEIFSGMDYANFPKMTK
GCH1_HAEIG      -------ETPMIDPTQAKNERRESIAKEVMKLIGLDLRDDSLEETPNRLAKMFDEIFSGMDYANFPKMTK
GCH1_SERP5      -------------------------------------------ETPHRIAKMYVDEIFSGLDYANFPKIT
GCH1_PECCP      -------------------------------------------ETPTRIAKMYVDEIFSGLDYANFPKIT
GCH1_ERWCT      -------------------------------------------ETPTRIAKMYVDEIFSGLDYANFPKIT
GCH1_VIBPA      ----------------------------------------------------------------------
GCH1_SHEDO      ---------------------------------------------PRRIAKMYDEIFSGL--DYDNFPKI
GCH1_PHOPR      ----------------------------------------------------------------------
GCH1_VIBVY      ---------------------------------------------PRRIAKMYDEVFSGLDQNFPKIT--
GCH1_VIBVU      ---------------------------------------------PRRIAKMYDEVFSGLDQNFPKIT--
GCH1_SODGM      -------------------------------------------ETPHRIAKMYVEEIFAGLDYANFPKIT
GCH1_SHELP      -------------------EKIEHHMREILTLMSLDLRDDSLVETPKRIAKMYDEIFSGLDENFPKIT--
GCH1_PYRAE      -------------TDRKAKAKPERGVEELLEYLGEDLTKPGVLNTPKRFVKAMEELTRGLRXXXXXXXXX
GCH1_THENV      ----------------------EEGVRALLEHLGEDVTRPGVVDTPKRFVKALGELTRGLRXXXXXXXXX
GCH1_SHESR      --------------------------KEILTLMXXXXXXXXXADTPRRIAKMYDEIFSGL--DYENFPKI
GCH1_SHESM      --------------------------KEILTLMXXXXXXXXXADTPRRIAKMYDEIFSGL--DYENFPKI
GCH1_SHESA      --------------------------KEILTLMXXXXXXXXXADTPRRIAKMYDEIFSGL--DYENFPKI
GCH1_SHESW      ----------------------EHHMKEILTLMXXXXXXXXXADTPRRIAKMYDEIFSGL--DYENFPKI
GCH1_SHEPC      ----------------------EHHMKEILTLMXXXXXXXXXADTPRRIAKMYDEIFSGL--DYENFPKI
GCH1_MUCHA      ----------------------------------------------------------------------
GCH1_ALISL      ----------------------------------------------------------------------
GCH1_BLOPB      ---------------KIRKRRIENHMRAIVXXXXXXXXXXXXXXTPKRIAKMYEEIFSGYSNFPKAIIQN
GCH1_SHEON      ----------------------EHHMKEILTLMXXXXXXXXXADTPRRIAKMYDEIFSGL--DYANFPKI
GCH1_SHEB9      ----------------------EHHMKEILTLMXXXXXXXXXADTPRRIAKMYDEIFSGL--DYANFPKI
GCH1_SHEB8      ----------------------EHHMKEILTLMXXXXXXXXXADTPRRIAKMYDEIFSGL--DYANFPKI
GCH1_SHEB5      ----------------------EHHMKEILTLMXXXXXXXXXADTPRRIAKMYDEIFSGL--DYANFPKI
GCH1_SHEB2      ----------------------EHHMKEILTLMXXXXXXXXXADTPRRIAKMYDEIFSGL--DYANFPKI
GCH1_SHEAM      ---------------------------------------------PRRIAKMYDEIFSGL--DYENFPKI
GCH1_VIBFM      ----------------------------------------------------------------------
GCH1_VIBF1      ----------------------------------------------------------------------
GCH1_PHOLL      ---------------EVRKARIEEHMTEVMKLLNLDLRDDSLAETPGRIAKMYDEIFSGYSNFPKITLIE
GCH1_CHRVO      ----------------------ERAVADMLTASGIDPIHTG--KTAQRVRELWKRLLDGYDTVPAEALGS
GCH1_AERS4      -------------------EKIEGHMRAIMETLGLDLTDDSLAETPHRIAKMYNEIFSGLTFPKVTVIEN
GCH1_AERHH      -------------------EKIEGHMRAIMETLGLDLADDSLAETPHRIAKMYNEIFSGLTFPKVTVIEN
GCH1_SHISS      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_SHIFL      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_SHIF8      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_SHIDS      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_SHIBS      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_SHIB3      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_RALSO      ----------------------ELAVQSLLEASGIEIDTAHTGKTAQRVRELWRRLLDGYDIDPAEALGH
GCH1_ESCF3      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECOUT      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECOSM      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECOSE      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECOLU      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECOLI      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECOLC      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECOL6      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECOL5      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECOK1      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECOHS      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECODH      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECOBW      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECO8A      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECO81      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECO7I      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECO5E      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECO57      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECO55      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECO45      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECO27      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_ECO24      ----------------------------IMQLLNLDLADDSLMETPHRIAKMYDEIFSGYANFPKITLIE
GCH1_HAMD5      ----------------------------------------------------------------------
GCH1_YERPY      -----------------------------------DLTDDSLADTPRRIAKMYDEIFSGLDENFPKIT--
GCH1_YERPG      -----------------------------------DLTDDSLADTPRRIAKMYDEIFSGLDENFPKIT--
GCH1_YERPE      -----------------------------------DLTDDSLADTPRRIAKMYDEIFSGLDENFPKIT--
GCH1_YERPB      -----------------------------------DLTDDSLADTPRRIAKMYDEIFSGLDENFPKIT--
GCH1_YERP3      -----------------------------------DLTDDSLADTPRRIAKMYDEIFSGLDENFPKIT--
GCH1_ENT38      ------------------------------------------METPQRIAKMYVDEIFSGLDYANFPKIT
GCH1_SALTY      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_SALTI      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_SALSV      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_SALPK      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_SALPC      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_SALPB      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_SALPA      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_SALNS      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_SALHS      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_SALEP      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_SALDC      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_SALCH      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_SALAR      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_SALA4      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_KLEP7      ------------------------------------------METPHRIAKMYDEIFSGL--DYSRFPKI
GCH1_KLEP3      ------------------------------------------METPHRIAKMYDEIFSGL--DYSRFPKI
GCH1_YERE8      --------------------------------------------TPRRIAKMYDEIFSGL--DYENFPKI
GCH1_SALG2      ------------------------------------------METPHRIAKMYDEIFAGYANFPKITLIE
GCH1_CITK8      ------------------------------------------METPHRIAKMYVDEIFSGLDYANFPKIT
GCH1_BAUCH      ----------------------------------------------------------------------
GCH1_BUCAP      --LLKGLENPILEYNDIKEKEREEYLYKIMSLLNLDLKNESLKDTPIRISKMYNEIFSGLDKNFPKIM--
GCH1_EUGGR      ----------------------------------------------------------------------
GCH1_BACPU      ----------------------------------------------------------------------
QUEF_TRIEI      ----------------------------------------------------------------------
ACY1_MOUSE      ---------------------------TVLTWPGTNPSLPSLLNSHTDVVPVFKEHWHHDPFEA------
UBID_IDILO      ----------------------------------------------------------GYIEPGEMAAEG


                         .         .         *         .         .         .         .:140
query           TFGDVEGYDDMVVEKNISVSSHCEHHMAPIVGTAHVAYIPNERVVGLSKLARVVEVFSKRLQTQERLTMQ
GCH1_PELUB      TFGDVEGYDDMVVEKNISVSSHCEHHMAPIVGTAHVAYIPNERVVGLSKLARVVEVFSKRLQTQERLTMQ
GCH1_MARMM      TFEDVQGYDDMVMLTNIDVESHCEHHLAPIMGVAHVAYLPSKAVVGISKIARVVEIFSKRMQTQETMTAQ
GCH1_BRUSU      TFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQTQESITAQ
GCH1_BRUSI      TFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQTQESITAQ
GCH1_BRUME      TFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQTQESITAQ
GCH1_BRUMB      TFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQTQESITAQ
GCH1_BRUC2      TFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQTQESITAQ
GCH1_BRUAB      TFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQTQESITAQ
GCH1_BRUA2      TFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQTQESITAQ
GCH1_BRUA1      TFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQTQESITAQ
GCH1_BRUO2      TFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQTQESITAQ
GCH1_HYPNA      TFEDVQGYDDIVMLRNIEVESHCEHHIAPFIGKAFIAYKPSTAVVGISKLARVVEIFAKRLQTQETMTAQ
GCH1_CAUCR      TFEDVQGYDDMVMLRGIDVQSHCEHHMAPFLGKAWIAYMPTGKVVGLSKLARLVEIFAKRLQTQETMTMQ
GCH1_BARQU      VFEEVSGYNEPVIVKDISFYSHCEHHMIPIVGKAHIAYLPDEKVVGLSKIARIVDVFSRRLQTQETMTAQ
GCH1_SINMW      TFEEVSGYDDIVLEKDIPFYSHCEHHMVPIIGKAHIAYLPNGRVLGLSKIARVVDIYARRLQTQEAMTAQ
GCH1_XYLFM      TFEEISGYDEMIVLRNITYESHCEHHMAPIIGKVHVGYLPNGKVVGISKLARVVESYARRFQIQEKMTAQ
GCH1_BARHE      VFEEVSGYNEPVIMKDLSFYSHCEHHMIPIVGKAHIAYFPDEKIVGLSKIARVVNVFSRRLQTQEAMTAQ
GCH1_XYLFA      TFEEISGYDELIVLRNITYESHCEHHMAPIIGKVHIGYLPNGKVVGISKLARVVESYARRFQIQEKMTAQ
GCH1_XANCP      TFEEVAGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLARVVESYARRFQVQEKMTAQ
GCH1_RHISN      TFEEVSGYDDIVLEKDVPFYSHCEHHMVPIIGKAHVAYLPNGRVLGLSKIARVVDIYARRLQTQEAMTAQ
GCH1_XYLFT      TFEEISCYDEMIVLRNITYESHCEHHMAPIIGKVHVGYLPNGKVVGISKLARVVESYARRFQIQEKMTAQ
GCH1_XYLF2      TFEEISCYDEMIVLRNITYESHCEHHMAPIIGKVHVGYLPNGKVVGISKLARVVESYARRFQIQEKMTAQ
GCH1_XANC5      TFEEVAGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLARVVESYARRFQVQEKMTAQ
GCH1_XANAC      TFEEVAGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLARVVESYARRFQVQEKMTAQ
GCH1_RHILO      TFEEVAGYDDLVIVKDIHFHSHCEHHMVPIIGKAHVGYLPDGKVVGLSKIARVVDIFAHRLQTQEALTAQ
GCH1_RHIME      TFEEVSGYDDIVLEKDIPFYSHCEHHMVPIIGKAHIAYLPNGRVLGLSKIARVVDIYARRLQTQEAMTAQ
GCH1_OCHA4      VFEEVGGYNDLVLVKDISFHSHCEHHMVPIIGKAHVAYLPDHKVVGLSKIARVVDIFARRLQTQESITAQ
GCH1_RHOPT      TFGETAGYDDFVLVRNISFTSHCEHHVMPFYGKAHIAYTPVERVVGLSKLARLVDIFARRLQTQEHLTAQ
GCH1_RHOPA      TFGETAGYDDFVLVRNISFTSHCEHHVMPFYGKAHIAYTPVERVVGLSKLARLVDIFARRLQTQEHLTAQ
GCH1_BARBK      VFEEVAGYDEPVIVKDIFFYSHCEHHMIPIIGKAHVAYLPDKKIVGLSKIARVVDVFAHRLQTQETMTAQ
GCH1_METS4      VFEEVEGYGDIVLVRDIPFHSHCEHHMVPFIGRAHIAYYPRRGVVGLSKLARVVDAFARRLQTQETMTAQ
GCH1_RHOP2      TFGETAGYDDFVLVRDISFTSHCEHHVMPFYGKAHIAYTPVERVVGLSKLARLVEIFARRLQTQEHLTAQ
GCH1_RHOPS      TFGETAGYDDFVLVRDIGFTSHCEHHVMPFYGKAHIAYTPVERVVGLSKLARLVEIFARRLQTQEHLTAQ
GCH1_RHOPB      TFGETAGYDDFVLIRDMSFTSHCEHHVMPFYGKAHIAYTPVERVVGLSKLARLVDIFAHRLQTQEHLTAQ
GCH1_AGRVS      TFEEVGGYNDIVLVRDIPFFSHCEHHMLPVIGKAHVAYLPNGRVLGLSKIARVVDLFARRLQTQETMTAQ
GCH1_AGRT5      TFEEVGGYDDVVLVRDIPFFSHCEHHMVPIVGKAHVAYLPAGRVLGLSKIARVVEIFGRRLQTQENMTAQ
GCH1_AZOC5      TFGEIGSFDDFVLLKDIPFTSHCEHHMVPFMGKAHVAYFPVERVVGLSKIARLVDLYARRLQTQEHLTSQ
GCH1_THEEB      AIFD-EGHDEMVLVRDINFFSLCEHHMLPFIGKAHVAYIPNQRVIGLSKLARVVEMYARRLQVQERLTRQ
GCH1_BEII9      VFEEVHGYDNMVLVRDIPFSSHCEHHMVPFFGVAHIGYYPSEAVIGLSKLARLVDIFAKRLQTQEALTAQ
GCH1_SYNP6      AIFD-EGHNEMVLVRDITAFSLCEHHMLPFMGKVHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQ
GCH1_SYNE7      AIFD-EGHNEMVLVRDITAFSLCEHHMLPFMGKVHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQ
GCH1_MESSB      TFEEVAGYEDMVLVKDIPFHSHCEHHMVPIVGKAHVGYLPDGKVVGLSKIARVVDIFARRLQTQEAITAQ
GCH1_BRAJA      TFGETAGYDDFVLVRDIEFTSQCEHHMMPFYGKAHIAYTPVERVVGLSKLARLTDIFARRLQTQEHLTAQ
GCH1_SYNJB      AIFD-EGHDEMVLLRDVSLFSLCEHHLLPFIGKAHVAYIPKQKVVGLSKIARIVEMYSRRLQVQERLTRQ
GCH1_RICBR      KFSDTGNFQDFISLEGIKFTSFCEHHMLPFSGTVHIAYIPDNCIVGISKLARIVNAFAKRLQIQEKMTVQ
GCH1_RICB8      KFSDTGNFQDFISLEGIKFTSFCEHHMLPFSGTVHIAYIPDNCIVGISKLARIVNAFAKRLQIQEKMTVQ
GCH1_RICTY      KFYDTYNFQDLISLEGIKFTSFCEHHILPFNGTVHIAYIPDNCIIGVSKLARIVNIFSRRLQIQEKMTVQ
GCH1_NOSP7      AIFD-EGHNEMVLVRDINFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQ
GCH11_ANASP     AVFD-EGHNEMVLVRDINFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQ
GCH1_SYNJA      AIFD-EGHDEMVLLRDITLFSLCEHHLLPFIGKAHVAYIPRQKVVGLSKIARIVEMYSRRLQVQERLTRQ
GCH1_CHLTE      AVF-TESYDEMVLVKDIDIYSMCEHHMLPFFGKAHVAYIPDGKIVGLSKIPRVVEVFARRLQVQERLTQQ
GCH1_CHLCH      ALF-TESYDEMVLVRDIDLFSMCEHHMLPFFGKAHVAYIPDGKIVGLSKLARVVEVFSRRLQVQERLTQQ
GCH1_FINM2      SFEIVD--DNMVIEKDIPFYSMCEHHLLPFWGKVNIAYIPNKRVAGLSKLARTVDVYSKKPQLQERLNIE
GCH1_SYNY3      AIFD-EGHNEMVLVRDIDFFSLCEHHMLPFMGKAHLAYIPNQKVVGLSKLARIVEMFSRRLQVQERLTRQ
GCH1_RICPR      KFYDICNFQDLISLEGIKFTSFCEHHILPFNGTVHIAYIPDNCIIGVSKLARIVNIFARRLQIQEKMTLE
GCH1_CLOPE      TF-EVHS-NDLVLEKDITFYSMCEHHLVPFYGKVHIAYIPNGRVVGLSKLARCVEVYSKKPQLQERLTKE
GCH1_PROVI      AVF-TESYDEMVLVKDIDIFSMCEHHMLPFFGKAHVAYIPDGKIVGLSKLARVVEVFARRLQVQERLTQQ
GCH1_CLOPS      TF-EVHS-NDLVLEKDITFYSMCEHHLVPFYGKVHIAYIPNGRVVGLSKLARCVEVYSKKPQLQERLTTE
GCH1_GLOVI      AIFDL-GHDELVLVRDIDLFSMCEHHMLPFIGRAHVGYIPDQKVVGLSKLARIVEMYARRLQVQERLTRQ
GCH1_CLOP1      TF-EVHS-NDLVLEKDITFYSMCEHHLVPFYGKVHIAYIPNGRVVGLSKLARCVEVYSKKPQLQERLTTE
GCH1_RICFE      KFYDTCNFQDFILLKDIKFTSFCEHHMLPFIGTVDIAYIPDNCIVGISKLARIVNAFSKRLQIQEKMTVQ
GCH1_CAEEL      AVFD-EDHDEMVIVKDIEMFSLCEHHLVPFMGKVHIGYIPNKKVLGLSKLARIVEMFSRRLQVQERLTKQ
GCH1_CAMJ8      ALFESSN-NEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLTEQ
GCH1_CAMJR      ALFESSN-NEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLTEQ
GCH1_RICAH      KFYDTCNFQDFISLEGIKFTSFCEHHMLPFNGTVHIAYIPDNCIVGISKLARIVNIFAKRLQIQEKMTVQ
GCH12_ANASP     AVF-TEDANEMVLIRDIDIFSSCEHHILPIIGRAHVAYIPNGKVIGLSKIARVCEMYARRLQVQERLTLQ
GCH1_CAMJE      ALFESSN-NEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLTEQ
GCH1_CAMJD      ALFESSN-NEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLTEQ
GCH1_CORGL      TFS--EGHEELVLVREIPIYSMCEHHLVPFFGVAHIGYIPGKKVTGLSKLARLADMFAKRPQVQERLTSQ
GCH1_COXBU      AVFQ-SGMDEMVILKDIELYSLCEHHLLPFIGRCHVAYLPSGKIIGISKLARIVDMFAKRLQVQENLTKQ
GCH1_COXBR      AVFQ-SGMDEMVILKDIELYSLCEHHLLPFIGRCHVAYLPSGKIIGISKLARIVDMFAKRLQVQENLTKQ
GCH1_COXBN      AVFQ-SGMDEMVILKDIELYSLCEHHLLPFIGRCHVAYLPSGKIIGISKLARIVDMFAKRLQVQENLTKQ
GCH1_CLOK5      VF--TVNNDDIVLEKDIQFYSMCEHHFMPFYGKTHVAYIPNGKVVGLSKLARTVEVFAKRLQLQERMTVQ
GCH1_CLOK1      VF--TVNNDDIVLEKDIQFYSMCEHHFMPFYGKTHVAYIPNGKVVGLSKLARTVEVFAKRLQLQERMTVQ
GCH1_CAMJJ      ALFESSN-NEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLTEQ
GCH1_BACA2      VFG--EDHEELVLVKDIAFHSMCEHHLVPFYGKAHIAYIPRGKVTGLSKLARAVEAVSKRPQLQERITST
GCH1_BACSU      IFG--ENHEELVLVKDIAFHSMCEHHLVPFYGKAHVAYIPRGKVTGLSKLARAVEAVAKRPQLQERITST
GCH1_CORGB      TFS--EGHEELVLVREIPIYSMCEHHLVPFFGVAHIGYIPGKKVTGLSKLARLADMLAKRPQVQERLTSQ
GCH1_CHICK      AIFD-EDHDEMVIVKNIDMFSLCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQ
GCH1_RAT        AIFD-EDHDEMVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQ
GCH1_RICPU      KFYETCNFRDFIL-LNIKFTSFCEHHILPFNGTVDIAYVPDNCIVGISKLARIVNIFARRLQIQEKMTVQ
GCH1_RICM5      KFYETCNFQDFIL-LNIKFTSFCEHHILPFNGTVDIAYVPDNCIVGISKLARIVNIFARRLQIQEKMTVQ
GCH1_WOLSU      VFED-GACDEMVVLKNIEFYSMCEHHMLPFFGKVSIGYIPDQKVVGISKLARLVEVFARRLQIQEKMTGQ
GCH1_DICDI      AIFN-ENHHEMVVVRDIDIFSLCEHHMVPFHGKCHIGYIPDQKVLGLSKLARVAEIFARRLQVQERLTRQ
GCH1_SCHPO      AVFQ-EDHEEMVIVRDIDVFSLCEHHLVPFIGKIHIGYIPRKRVLGLSKLARIANMFSRRLQVQERLTKQ
GCH1_RICAE      KFYETCNFQDFIL-LNIKFTSFCEHHILPFNGTVDIAYIPDNCIVGISKLARIVNIFARRLQIQEKMTVQ
GCH1_STRSY      VFS--EGHEEVVLVKDIPFHSMCEHHLVPFYGIAHVAYIPSKRVTGLSKLARAVEVASRRPQLQERLTHQ
GCH1_STRS2      VFS--EGHEEVVLVKDIPFHSMCEHHLVPFYGIAHVAYIPSKRVTGLSKLARAVEVASRRPQLQERLTHQ
GCH1_RICRS      KFYETCNFRDFIL-LNIKFTSFCEHHILPFNGTVDIAYVPDNCIVGISKLARIVNIFARRLQIQEKMTVQ
GCH1_RICRO      KFYETCNFRDFIL-LNIKFTSFCEHHILPFNGTVDIAYVPDNCIVGISKLARIVNIFARRLQIQEKMTVQ
GCH1_RICCN      KFYETCNFRDFIL-LNIKFTSFCEHHILPFNGTVDIAYVPDNCIVGISKLARIVNIFARRLQIQEKMTVQ
GCH1_STRAW      TF-DI-GHDEMVLVKDIEVLSSCEHHLVPFVGVAHVGYIPSTKITGLSKLARLVDVYARRPQVQERLTTQ
GCH1_BACAH      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_STRPN      SFEIID--DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIE
GCH1_STRPJ      SFEIID--DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIE
GCH1_STRP7      SFEIID--DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIE
GCH1_STRP4      SFEIID--DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIE
GCH1_STRR6      SFEIID--DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIE
GCH1_STRP2      SFEIID--DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIE
GCH1_CAMC5      ALF-TSSNNEMVLMRNIEFYSLCEHHLLPIIGRVHVAYIPNGKVVGLSKIPRMVNIYARRLQIQEQMTEQ
GCH1_AZOVD      ALFSSDN-SEMVMVKNIELYSLCEHHMLPFIGKAHVAYLPNGKVLGLSKVARIVDMFARRLQIQENLTRQ
GCH1_PORGI      AMFE-EDYQQMVIVKDIDFFSMCEHHMLPFFGKAHVGYIPNRYITGLSKLPRVVDVFARRLQVQERLTTQ
GCH1_PORG3      AMFE-EDYQQMVIVKDIDFFSMCEHHMLPFFGKAHVGYIPNRYITGLSKLPRVVDVFARRLQVQERLTTQ
GCH1_LEPIN      AIFE-EPTEGMVLVRDIEMYSLCEHHLLPFYGKAHVAYLPNKKIIGISKIPRIVDVFARRLQVQERLTEQ
GCH1_LEPIC      AIFE-EPTEGMVLVRDIEMYSLCEHHLLPFYGKAHVAYLPNKKIIGISKIPRIVDVFARRLQVQERLTEQ
GCH1_LEPBL      AIFE-ESTEGMILVRDIEVYSLCEHHLLPFYGRAHVAYLPNKKIIGISKIPRIVDVFARRLQVQERLTEQ
GCH1_LEPBJ      AIFE-ESTEGMILVRDIEVYSLCEHHLLPFYGRAHVAYLPNKKIIGISKIPRIVDVFARRLQVQERLTEQ
GCH1_STRMU      VFS--EEHEDVVLVKDIPFYSMCEHHLVPFHGLAHVAYIPSDGVTGLSKLARAVEVVSKRPQLQERLTVQ
GCH1_STRCO      TFD--LGHDEMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPSTKITGLSKLARLVDVYARRPQVQERLTTQ
GCH1_MYCVP      MFD--EQHDEMVLVKDIPMYSTCEHHLVSFHGVAHVGYIPDGRVTGLSKLARVVDLYAKRPQVQERLTGQ
GCH1_MYCGI      MFD--EQHDEMVLVKDIPMYSTCEHHLVSFHGVAHVGYIPDGRVTGLSKLARVVDLYAKRPQVQERLTSQ
GCH1_MOUSE      AIFD-EDHDEMVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQ
GCH12_PSEAE     ALFSSDN-SEMVLVKDIELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENMSRQ
GCH1_STRPY      VF--TEHHEDVVIVKDISFYSMCEHHQVPFYGKAHIAYLPSDRVTGLSKLARAVEVASKRPQLQERLTAQ
GCH1_CARHZ      YF--TEEHEEMVLVKDIPLYSMCEHHLLPFYGKAHVAYIPRKKVTGLSKLARVVEGFAKRPQLQERLTSQ
GCH1_BACWK      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_BACHK      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_BACCZ      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_BACCR      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_BACCQ      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_BACC7      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_BACC4      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_BACC3      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_BACC2      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_BACC1      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_BACC0      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_BACAN      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_BACAC      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_BACAA      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGKVTGLSKLARTVDTIARRPQLQERITST
GCH12_PSEPK     ALFESEN-DEMIVVRDIELYSLCEHHMLPFIGKAHVAYLPTGRVLGLSKVARVVDMFARRLQIQENLTRQ
GCH1_THEFY      VFE--ANHEEMVLVKDIELYSTCEHHLVPFYGAAHVGYIPNTRITGLSKLARLVDIYARRPQVQERLTSQ
GCH1_STRZP      SFEIID--DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIE
GCH1_STRZJ      SFEIID--DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIE
GCH1_STRPS      SFEIID--DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIE
GCH1_STRPI      SFEIID--DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIE
GCH1_STRZT      SFEIID--DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIE
GCH1_METCA      AVFEADS-EDMVIVKDIELYSLCEHHLLPFIGKCHVGYLPQGKVIGLSKIARIVEMYARRLQIQERLTKQ
GCH1_BACP2      IFG--EDHEELVLVKDIAFHSMCEHHLVPFYGKAHVAYIPRGKVTGLSKLARAVEAVAKRPQLQERITST
GCH1_ALHEH      AVFSSDN-DEMVIVRNIELYSLCEHHLLPFIGRAHVAYLPDGKVIGLSKVARIVDMYARRLQIQENLTRQ
GCH1_STRGG      TFD--LGHDEMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPTGKITGLSKLARLVDVYARRPQVQERLTTQ
GCH1_BACCN      VFG--EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPRGKVTGLSKLARTVDTIARRPQLQERITST
GCH1_PARD8      AMFQEEDYKQMVIVKDIDFFSLCEHHMLPFFGKAHVAYIPKKYITGLSKIPRVVDIFARRLQIQERMTMQ
GCH1_JANMA      FEDGAEQYNELIVVRGIPVYSHCEHHLAPFFGTATIGYTPNGKIVGLSKLTRLVDCFAKRLQVQERLTIQ
GCH1_COREF      TFS--EDHQELVLVREIPIYSTCEHHLVPFFGVAHIGYIPGEQVTGLSKLARLADMYAKRPQVQERLTSQ
GCH1_STRA5      VFS--ENHEEVVIVKDIPFYSMCEHHLVPFYGKAHIAYLPNDRVTGLSKLARAVEVASKRPQLQERLTAQ
GCH1_RHOBA      VFA--EDYDEIVLVRDISFCSMCEHHLLPFTGKAHIAYLPSGKVVGLSKLARVVEEVARRPQVQERLTHT
GCH1_CAMLR      ALFESSN-NEMVLVRDIEFYSLCEHHLLPFFGRVHVAYIPDKKVVGLSKIPRLVEVFARRLQIQEQLTEQ
GCH1_STRA1      VFS--ENHEEVVIVKDIPFYSMCEHHLVPFYGKAHIAYLPNDRVTGLSKLARAVEVASKRPQLQERLTAQ
GCH1_HUMAN      AIFD-EDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQ
GCH1_DESRM      TFS--EEHEEMVIVKDIRLFSMCEHHLIPFIGKAHVCYIPNGNVTGLSKLARLVNGYARRPQLQERLTKQ
GCH1_OSTOS      AVFD-ENHDEMVIVRDIEMFSLCEHHLVPFNGKVHIGYIPNKKVLGLSKLARIVEMFSRRLQVQERLTKQ
GCH1_CAMC1      --GDASSNNEMVLMRNIEFYSLCEHHLLPIIGRVHVAYIPNGKVVGLSKIPRMVNIYARRLQIQEQMTEQ
GCH1_LEPBP      AIFE-ENTTGMVLVRDIEMYSLCEHHLLPFYGRAHVAYIPNKKIIGISKIPRIVDVFARRLQVQERLTDQ
GCH1_LEPBA      AIFE-ENTTGMVLVRDIEMYSLCEHHLLPFYGRAHVAYIPNKKIIGISKIPRIVDVFARRLQVQERLTDQ
GCH11_PSEAE     ALFASDN-DEMVIVRDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKVARIVDMFARRLQIQENLTRQ
GCH1_STRPG      VFK--EHHEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDRVTGLSKLARAVEVASKRPQLQERLTSQ
GCH1_STRP8      VFK--EQHEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDRVTGLSKLARAVEVASKRPQLQERLTSQ
GCH1_STRP6      VFK--EQHEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDRVTGLSKLARAVEVASKRPQLQERLTSQ
GCH1_STRP3      VFK--EHHEDVVIVKDISFYSVCEHHLVPFYGKAHIAYLPSDRVTGLSKLARAVEVASKRPQLQERLTSQ
GCH1_STRP1      VFK--EQHEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDRVTGLSKLARAVEVASKRPQLQERLTSQ
GCH1_MYCA9      TFD--EQHDELVLVKSIPMYSTCEHHLVSFHGVAHVGYIPGQRVTGLSKIARLVDLYAKRPQVQERLTAQ
GCH1_STRPZ      VFK--EQHEDVVIVKGISFYSICEHHLVPFYGKAHIAYLPSDRVTGLSKLARAVEVASKRPQLQERLTSQ
GCH1_STRA3      VFS--ENHEEVVIVKDIPFYSMCEHHLVPFYGKAHIAYLPNDRVTGLSKLARAFEVASKRPQLQERLTAQ
GCH1_PELTS      IFS--EEHEEMVIVKDIPLYSICEHHLLPFYGKAHVAYIPRKKVTGLSKLARVVEGFAKRPQLQERLTSQ
GCH1_CORA7      TFA--EEHQELVLVRDIPIYSTCEHHLVPFYGTAHIGYIPGTHVTGLSKLARLADMYAKRPQVQERLTSQ
GCH1_LYSSC      VFH--EDHEELVLVKDIPFYSMCEHHLVPFYGKAHVAYIPNDGIVGLSKLGRAVETIARRPQLQERITSS
GCH1_BREBN      VFS--EDHEEMVLVKDIPFYSMCEHHLVPFFGKAHVAYVPRGRVVGLSKLARAVDTVAKRPQLQERITAT
GCH1_THEPX      IFQEDE-HQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKRILGLSKLARIVDILAKRPQLQERLTSE
GCH1_THEP3      IFQEDE-HQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKRILGLSKLARIVDILAKRPQLQERLTSE
GCH1_STRT2      VFSEV--HDEVVLVKDIPFYSMCEHHLVPFYGMAHVAYLPSDKVTGLSKLARAVEVAARRPQLQERLTDQ
GCH1_STRT1      VFSEV--HDEVVLVKDIPFYSMCEHHLVPFYGMAHVAYLPSDKVTGLSKLARAVEVAARRPQLQERLTDQ
GCH1_GEOSW      VFS--EDHEELVLVKDIPFYSMCEHHLVPFFGVAHVAYIPRGKVTGLSKLARAVETVARRPQLQERITAT
GCH1_BACHD      IFG--EDHEELVLVKDIPFFSMCEHHLVPFFGKAHVGYIPKGKVTGLSKLARAVEAVARRPQLQERITST
GCH1_BACFR      AKFQEE-YSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQVQERMTLQ
GCH1_BACFN      AKFQEE-YSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQVQERMTLQ
GCH1_THETN      IFQEDE-HQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKRILGLSKVARIVDVLSKRPQLQERLTSE
GCH1_YEAST      NAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKKVIGLSKLARLAEMYARRLQVQERLTKQ
GCH1_GEOKA      VFS--EEHEELVLVKDIPFYSMCEHHLVPFFGAAHVAYIPREKVTGLSKLARAVEAVARRPQLQERITAT
GCH1_BACTN      AKFQEE-YSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQVQERMTLQ
GCH1_DEHSC      -VGYELGHREMVIIKDIPFYSMCEHHLLPFSGVVHIGYIPNGRVVGISKLARVVEIYAKRPQIQERMATQ
GCH1_DEHSB      -VGYELGHREMVIIKDIPFYSMCEHHLLPFSGVVHIGYIPNGRVVGISKLARVVEIYAKRPQIQERMATQ
GCH1_CLOD6      LFAD-EKHEELVLVKDIPFYSCCEHHLVPFFGKAHIAYLPKGRLTGLSKLARVIDTLAKRPQLQERITKN
GCH1_STRGC      VFS--EGHEEVVLVKDIPFHSMCEHHLLPFYGVAHVAYLPNGKVTGLSKLARAVEVASKRPQLQERLTAQ
GCH1_CHRSD      AVFESQT-DEMVLIKDIELYSMCEHHLLPFIGKCHIAYLPEGRVLGLSKFARIVDMYARRMQIQENLTRQ
GCH1_NEUCR      AIFQ-EGHNEMVIVKDIEVFSMCEHHLVPFTGKMHIGYIPSNAVIGISKLPRIAELFARRLQIQERLTKE
GCH1_MYCTU      MFD--EDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDRVTGLSKIARLVDLYAKRPQVQERLTSQ
GCH1_MYCTA      MFD--EDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDRVTGLSKIARLVDLYAKRPQVQERLTSQ
GCH1_MYCBT      MFD--EDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDRVTGLSKIARLVDLYAKRPQVQERLTSQ
GCH1_MYCBP      MFD--EDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDRVTGLSKIARLVDLYAKRPQVQERLTSQ
GCH1_MYCBO      MFD--EDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDRVTGLSKIARLVDLYAKRPQVQERLTSQ
GCH1_DEHE1      -VGYELGHREMVIIKDIPFYSMCEHHLLPFSGVVHIGYIPNGRVVGISKLARVVEIYAKRPQIQERMATQ
GCH1_MYCLE      MFD--EEHNELVIVKEIPMYSTCEHHLVSFHGVAHIGYLPGARVTGLSKIARLVDLYAKRPQVQERLTSQ
GCH1_MYCLB      MFD--EEHNELVIVKEIPMYSTCEHHLVSFHGVAHIGYLPGARVTGLSKIARLVDLYAKRPQVQERLTSQ
GCH1_CLOTH      VFQE-ENHEEMVMVKDIPIYSICEHHLLPFIGVAHVVYIPRKKIMGLSKLARIVDIIARKPQLQERLGSE
GCH1_SULSY      IFEEVGSYDEMVVVRDIQFYSLCEHHLLPFFGKAHVAYIPDKKVCGLSKIVRVVNKFSYRPQVQERLTAE
GCH1_PERMH      VFEDIGDYNEMVVVRDIQFYSFCEHHLLPFFGKAHIAYIPEKKVCGLSKLVRVVNKFAYRPQVQERLTAQ
GCH1_NITMU      TFADGESYDELIVVRQIPVYSHCEHHLAPFFGHATIGYLPTGHIVGLSKLTRLVNCFAARLQVQERLTQQ
GCH1_MYCPA      MFD--EEHDELVLVKEIPLYSTCEHHLVSFHGVAHVGYIPGNRVTGLSKIARLVDLYAKRPQVQERLTSQ
GCH1_LISW6      IFA--EQHEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPNGRVAGLSKLARVVDDVSKRPQLQERITTT
GCH11_PSESM     ALFASDN-DEMVIVQNIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKIARIVDMFARRLQIQENLTKQ
GCH1_THEYD      IEG--ETHDEMVLIKDIPFYSVCEHHLLPFFGNAHIAYIPDGRIVGLSELPKALDYLSKRPQVQERLTSQ
GCH1_MYCA1      MFD--EEHDELVLVKEIPLYSTCEHHLVSFHGVAHVGYIPGNRVTGLSKIARLVDLYAKRPQVQERLTSQ
GCH1_LISMO      IFE--EQHEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPNGRVAGLSKLARVVDDVSRRPQLQERITTT
GCH1_LISMH      IFE--EQHEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPNGRVAGLSKLARVVDDVSRRPQLQERITTT
GCH1_LISMF      IFE--EQHEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPNGRVAGLSKLARVVDDVSRRPQLQERITTT
GCH1_LISMC      IFE--EQHEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPNGRVAGLSKLARVVDDVSRRPQLQERITTT
GCH1_LISIN      IFE--EQHEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPNGRVAGLSKLARVVDDVSRRPQLQERITTT
GCH1_BIFLD      HF-DVDT-DELVLVKDIELYSVCEHHLLPFHGVAHVGYIPKDGVMGLSKLARLVEVYARRPQVQERLTQQ
GCH1_PSEA6      AIFEADT-DEMVVIQNIEYYSLCEHHILPFIGQCHIAYLPQGKVLGLSKFARIVDMYARRLQIQEGLTKQ
GCH1_STRSV      SFEIID--NNMVVEKDIFFHSMCEHHFLPFYGKVHIAYVPNGRVAGLSKLARTVEVYAKKPQIQERLTVE
GCH1_DEIRA      GVFAAEG-SEMVIVKDIEFYSMCEHHMLPFYGRAHVAYIPGTRILGLSKFARIVDLYSRRLQVQERITTQ
GCH1_CLONN      SXXXXXXXXXXXXXXXIQFYSMCEHHFLPFFGKVHIAYIPNGKVVGLSKLARTTEVFSKRPQLQERLTSQ
GCH1_ONCMY      AILD-EDHDEMVIVKDIDMFSMCEHHLVPIFGRVHIGYLPNKRVLGLSKLARIVEIYSRRLQVQERLTKQ
GCH1_PSEHT      AVFTSDA-DDMVLVQDIELYSMCEHHLLPFTGRCHIAYIPNGKVLGLSKFARIVDMFARRFQIQEQLTHQ
GCH1_HELPY      AY--FQGVDEMIVAQNIEFYSTCEHHLLPFLGNISVGYIPKEKIVGISAIAKLIEIYSRRLQIQERLTIQ
GCH1_HELP2      AY--FQGVDEMIVAQNIEFYSTCEHHLLPFLGNISVGYIPKEKIVGISAIAKLIEIYSKRLQIQERLTTQ
GCH1_BIFLO      HF-DVDT-DELVLVKDIELYSVCEHHLLPFHGVAHVGYIPKDGVMGLSKLARLVEVYARRPQVQERLTQQ
GCH1_AQUAE      LFEEFGGYNEMVLVKDIKFYSLCEHHLLPFFGKVHIAYIPDKKISGLSKLVRTVRAFALRPQVQERLTEE
GCH1_HELPJ      AY--FQGVDEMIVAQNIEFYSTCEHHLLPFFGNISVGYIPKEKIVGISAIAKLIEIYSKRLQIQERLTTQ
GCH1_HELPG      AY--FQGVDEMIVAQNIEFYSTCEHHLLPFFGNISVGYIPKEKIVGISAIAKLIEIYSKRLQIQERLTTQ
GCH1_HAHCH      AVFESDT-DEMVLVKDIELYSLCEHHLLPFIGRCHIAYIPNGKVLGLSKFARIVDMFARRMQIQENLTRQ
GCH12_PSESM     ALFSSDA-SEMVMVKDIELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENLSRQ
GCH1_MYCUA      MFD--EDHDELVLIKEIPLYSTCEHHLVSFHGVAHVGYIPGRRVTGLSKIARLVDLYAKRPQVQERLTSQ
GCH1_MYCMM      MFD--EDHDELVLIKEIPLYSTCEHHLVSFHGVAHVGYIPGRRVTGLSKIARLVDLYAKRPQVQERLTSQ
FOLKE_LACLA     KLFEIDSSDSIVLIKDIPFYSMCEHHMLPFFGKAHVAYIPADKIIGLSKIPRLVDYVSRKLSVQENITHD
GCH1_HELPS      AY--FQGVDEMIVAQNIEFYSTCEHHLLPFLGNISLGYIPKEKIVGISAIAKLIEIYSRRLQIQERLTTQ
GCH1_FLAJ1      TFDNNYKYGEMLVEKNITVYSTCEHHLLPIIGRAHVAYISSGRVIGLSKMNRIVEYYAKRPQVQERLTMQ
GCH1_HELPH      AY--FQGVDEMIVAQNIEFYSTCEHHLLPFLGNISLGYIPKEKIVGISAIAKLIEIYSKRLQIQERLTTQ
FOLKE_LACLM     FEIDSSKNDSIVLIKDIPFYSMCEHHMLPFFGKAHVAYIPDGRIIGLSKIPRLVNYVSRKLSVQENITHD
GCH1_TERTT      ALFPSDS-NDMVVVRDIELFSLCEHHMLPFIGKAHVGYIPTGKVLGLSKVARIIDMYARRLQIQEQLTHQ
GCH1_LACPL      KLFKVEHPTEMVLLKDIPFYSMCEHHLLPFFGTVQVAYVPHEQVIGLSKIPRLIDYCSQQPNVQERLTVS
GCH11_PSEPK     ALFSSDN-SEMVLVRDIELYSMCEHHMLPFIGKAHVAYLPKGKVLGLSKVARIVDMYARRLQIQENLSRQ
GCH1_DROME      AVFD-EDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSRRLQVQERLTKQ
GCH1_CLOAB      TFEEESEEDNIVLVKDIEIFSHCEHHLTLMYNTVAVAYIPNKRLIGLSKIARIADMVSRRLQLQERIGKD
GCH1_HYDS0      LFEEYSNYSEMIIVKDIPFYSMCEHHLLPFFGKAHIAYIPNKKICGLSKLVRTVRAMALKPQVQERLTEE
GCH1_HELAH      AY--FQGVDEMIVAQHIEFYSTCEHHLLPFFGNISLGYIPKEKIIGISAIAKLIEIYSKRLQIQERLTTQ
GCH1_HYPBU      T--------DLVVVSGIRFYSLCEHHLLPFFGVAHVAYLPRGKVIGLSKIVRIVNKYSRRLQIQERMTKQ
GCH1_ENTFA      -FDDYKLFDEMVLVKDIAFYSMCEHHLLPFYGKVHVAYLPEGKVLGLSKLPRLVEHCAKRPTVQEDLTVT
GCH1_FUSNN      TF-EVNS-NELIMEKNMDFYSMCEHHFLPFFGTVCIAYVPNKKIFGFGDILKLIEILSRRPQLQERLTEE
GCH1_LEIXX      PVPLEQGQAETVILREISFRSVCEHHLLPFIGVAHVAYLPGEAVIGLGRIPRVIDTLAARPQVQERLTEQ
GCH1_LACSS      FETEETDDDQMVMMQDIPFYSMCEHHMLPFFGQVSVAYLPNGQIIGLSKIPRLVDFVSKRLSVQENLTRD
GCH1_HELHP      VFEDGV-CDEMIVLKKLHFYSICEHHLLPFFGHISIGYIPDKKLVGISGLARLTEVFTHRLQIQERLTAQ
GCH1_CLOCE      TFEEPKDNKEIVLVKDIDIFSYCEHHMALMYNMVAVAYIPNDKILGLSKIARIADMVGKRLQLQERIGSD
GCH1_CLOB8      AFGDSETHNNMVVVKDIPIHSYCEHHLALMYNMVTVVYIPKDKIIGLSKISRIADMVGRRLQLQERIGTD
GCH1_SULTO      TFGISEVEDQIILVKNIGFSSLCEHHLLPIIGKVHVAYIVGQKVAGFSKIIRIVNYYASRPQIQERLVQQ
GCH1_CALMQ      ----FEGSSNMVIVAGIRFSTLCEHHLLPMLGVTHVAYIPSDKVIGVSKIPRIVVKYSRMLQLQERLTRQ
GCH1_SULIN      SLGDGEAYEQIVLIKDVNFSSLCEHHMLPIIGKIHVAYIVSNKVAGFSKIIRIVNYYSSRLQIQERLVEQ
GCH1_SULSO      NLGDVYEKNQIVLIKDVNFSSLCEHHMLPIIGKIHVAYIVSNKVAGFSKIIRIVNYYSSRLQIQERLVEQ
GCH1_SULIY      SLGDGEVYEQIVLIKDVNFSSLCEHHMLPIIGKIHVAYIVSNKVAGFSKIIRIVNYYSSRLQIQERLVEQ
GCH1_SULIM      SLGDGEVYEQIVLIKDVNFSSLCEHHMLPIIGKIHVAYIVSNKVAGFSKIIRIVNYYSSRLQIQERLVEQ
GCH1_SULIL      SLGDGEVYEQIVLIKDVNFSSLCEHHMLPIIGKIHVAYIVSNKVAGFSKIIRIVNYYSSRLQIQERLVEQ
GCH1_SULIK      SLGDGEVYEQIVLIKDVNFSSLCEHHMLPIIGKIHVAYIVSNKVAGFSKIIRIVNYYSSRLQIQERLVEQ
GCH1_SULIA      SLGDGEVYEQIVLIKDVNFSSLCEHHMLPIIGKIHVAYIVSNKVAGFSKIIRIVNYYSSRLQIQERLVEQ
GCH1_SULAC      SLAENENSDQIVLVKDISFSSLCEHHLLPIIGKVHVAYVVGKKVAGLSKIIRLVNYYASRPQIQERLVEQ
GCH1_VIBCH      VIENKMKVSEMVKVKDITLTSTCEHHLVTIDGTAAVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQ
GCH1_CLOB6      TFEESDNVGDMVFMKDIEIFSHCEHHLALMYNMVAIAYIPKGKIIGLSKIARIADMVGRRLQLQERIGSD
GCH1_CLOBL      TFEDDDNENDMVFMKEIEIFSHCEHHLALMYNMVAIAYIPKKKIIGLSKIARIADMVGRRLQLQERIGSD
GCH1_CLOBK      TFEDDDNENDMVFMKEIEIFSHCEHHLALMYNMVAIAYIPKKKIIGLSKIARIADMVGRRLQLQERIGSD
GCH1_CLOBH      TFEDDDNENDMVFMKEIEIFSHCEHHLALMYNMVAIAYIPKKKIIGLSKIARIADMVGRRLQLQERIGSD
GCH1_CLOB1      TFEDDDNENDMVFMKEIEIFSHCEHHLALMYNMVAIAYIPKKKIIGLSKIARIADMVGRRLQLQERIGSD
GCH1_CLOBJ      TFEDDDNENDMVFMKEIEIFSHCEHHLALMYNMVAIAYIPKKKIIGLSKIARIADMVGRRLQLQERIGSD
GCH1_PHYBL      -----EDHDEMVIVKDVDIFSLCEHHKVPSTGKISIGYIPNRRVVGLSKLARIAEMFSRRLQVQERLTKQ
GCH1_HAEDU      TIENRMKVSEMVLVDDITLTSTCEHHFVTIDGKVAVAYYPKKWVIGLSKINRVVQFFAQRPQVQERFTEQ
GCH1_MANSM      -ITNIENVSEMVLVNDVTLTSTCEHHFVTIDGLVSVAYYPKKWVIGLSKINRVVQFFAQRPQVQERLTEQ
GCH1_ACTPJ      IENRMK-VSEMVLVDDITLTSTCEHHFVTIDGKVAVAYYPKKWVIGLSKINRVVQFFAQRPQVQERFTEQ
GCH1_ACTP7      IENRMK-VSEMVLVDDITLTSTCEHHFVTIDGKVAVAYYPKKWVIGLSKINRVVQFFAQRPQVQERFTEQ
GCH1_ACTP2      IENRMK-VSEMVLVDDITLTSTCEHHFVTIDGKVAVAYYPKKWVIGLSKINRVVQFFAQRPQVQERFTEQ
GCH1_VIBHB      VIENKMNVSEMVRVKDITVTSTCEHHLVTIDGKAAVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQ
GCH1_CLOBM      TFEDDDNENDMVFMKEIEIFSHCEHHLALMYNMVAIAYIPKGKIIGLSKMARIADMVGRRLQLQERIGSD
GCH1_HAES2      T--NIENVSEMVLVDDVTLTSTCEHHFVTIDGKVSVAYYPQKWVIGLSKINRVVAFFAQRPQVQERLTQQ
GCH1_HAES1      T--NIENVSEMVLVDDVTLTSTCEHHFVTIDGKVSVAYYPQKWVIGLSKINRVVAFFAQRPQVQERLTQQ
GCH1_EDWI9      NKMDV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKERVIGLSKINRIVRFFAQRPQVQERLTQQ
GCH1_PASMU      NIENRMKVSEMVLVNDVTLTSTCEHHFVTIDGMVSVAYYPKKWVIGLSKINRIVAFFAQRPQVQERLTEQ
GCH1_ERWT9      VIENKMKVDEMVTVRDITLTSTCEHHFVIIDGQATVAYIPKDKVIGLSKINRIVQFFSSRPQVQERLTQQ
GCH1_BLOFL      IIANTMQISEMITVRNINITSVCEHHFIIFNGKATVSYIPRKSVIGLSKINKIVEFFSKRPQLQERLTQQ
GCH1_TOLAT      IENKM-GTDEMIKVQDIGLTSTCEHHFVTIDGKATVAYIPKDKIIGLSKINRIVNFFAKRPQVQERLTQQ
GCH1_HAEIE      IKNQMK-VSEMVQVNDITLTSTCEHHFVTIDGKVCVAYYPKDWVIGLSKINRIVSFFAQRPQVQERLTEQ
GCH1_HAEI8      IKNQMK-VSEMVQVNDITLTSTCEHHFVTIDGKVCVAYYPKDWVIGLSKINRIVSFFAQRPQVQERLTEQ
GCH1_WIGBR      NTSKI---NDLITVNNIVLNSTCEHHFLIFEGKAIVSYIPDKILIGLSKINRIVDFFSKRPQIQERLTNQ
GCH1_HAEIN      IKNQMK-VSEMVQVNDITLTSTCEHHFVTIDGKVCVAYYPKDWVIGLSKINRIVSFFAQRPQVQERLTEQ
GCH1_HAEIG      IKNQMK-VSEMVQVNDITLTSTCEHHFVTIDGKVCVAYYPKDWVIGLSKINRIVSFFAQRPQVQERLTEQ
GCH1_SERP5      VIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDAVIGLSKINRIVQFFSQRPQVQERLTQQ
GCH1_PECCP      IIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDGVIGLSKLNRIVQFFSQRPQVQERLTQQ
GCH1_ERWCT      IIENKMKVDEMVTVRDITLTSTCEHHFVMIDGKATVAYIPKDGVIGLSKLNRIVQFFSQRPQVQERLTQQ
GCH1_VIBPA      ---------EMVRVKDITVTSTCEHHLVTIDGKAAVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQ
GCH1_SHEDO      TVIDNKGFDEMVRVQDISLTSTCEHHLVTIDGLATVAYLPRAKIIGLSKINRIVRFFAQRPQVQERLTQQ
GCH1_PHOPR      --------DEMVRVKGITLTSTCEHHLVTIDGKATVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQ
GCH1_VIBVY      VIENKMNVSEMVRVKEITLTSTCEHHLVTIDGKAAVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQ
GCH1_VIBVU      VIENKMNVSEMVRVKEITLTSTCEHHLVTIDGKAAVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQ
GCH1_SODGM      VIENKMKVDEMVTVRDITLTSTCEHHFVIIDGKATVSYIPKHCVIGLSKINRIVQFFAQRPQVQERLTQQ
GCH1_SHELP      VIENKMGFDEMVKVNDISLTSTCEHHLVTIDGVATVAYLPRKNIIGLSKINRIVRFFAQRPQVQERXXXX
GCH1_PYRAE      XLEDVEL--GPVVIENIGAVSLCEHHLLPILLRISVAYVPGDGVPGLSKVIRLVKWAAARPIMQERFTEW
GCH1_THENV      XL-EYDAEPGPVVIENISAVSLCEHHLLPILLSVSVAYIPGDGVPGLSKVIRLVKWAAARPIMQERFTEW
GCH1_SHESR      TVIDNKGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYIPRKKIIGLSKINRIVRFFSQRPQVQERXXXX
GCH1_SHESM      TVIDNKGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYIPRKKIIGLSKINRIVRFFSQRPQVQERXXXX
GCH1_SHESA      TVIDNKGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYIPRKKIIGLSKINRIVRFFSQRPQVQERXXXX
GCH1_SHESW      TVIDNKGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPRKKIIGLSKINRIVRFFAQRPQVQERXXXX
GCH1_SHEPC      TVIDNKGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPRKKIIGLSKINRIVRFFAQRPQVQERXXXX
GCH1_MUCHA      --------------------SMCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENLSRQ
GCH1_ALISL      --------DEMVRVNDITLTSTCEHHLVTIDGKATVAYIPREKIIGLSKINRIVRFFAQRPQVQERMTQQ
GCH1_BLOPB      TMQ----INEMITVRGINITSTCEHHFIVFNGKVTISYIPEKNVIGLSKINRIVQFFSKRPQLQERLTKQ
GCH1_SHEON      TVIDNKGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPRKKIIGLSKINRIVRFFAQRPQVQERXXXX
GCH1_SHEB9      TVIDNKGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPRKKIIGLSKINRIVRFFAQRPQVQERXXXX
GCH1_SHEB8      TVIDNKGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPRKKIIGLSKINRIVRFFAQRPQVQERXXXX
GCH1_SHEB5      TVIDNKGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPRKKIIGLSKINRIVRFFAQRPQVQERXXXX
GCH1_SHEB2      TVIDNKGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPRKKIIGLSKINRIVRFFAQRPQVQERXXXX
GCH1_SHEAM      TVIDNKGVDEMVRVQDISLTSTCEHHLVTIDGTATVAYLPRKKIIGLSKINRIVRFFAQRPQVQERLTXX
GCH1_VIBFM      --------DEMVRVNDITLTSTCEHHLVTIDGKATVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQ
GCH1_VIBF1      --------DEMVRVNDITLTSTCEHHLVTIDGKATVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQ
GCH1_PHOLL      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDKVIGLSKINRIVQFFSQRPQVQERXXXX
GCH1_CHRVO      GFADERR--DMVVIRSLAVHGMCPHHLLPFRGVAHVAYLPGGRLHGFGRIARMVDAISHRYTYQEWITHE
GCH1_AERS4      KMK----VDEMIMVRDISLTSTCEHHFVTIDGLAHVAYIPRGKVIGLSKINRIVQFFARRPQVQERXXXX
GCH1_AERHH      KMK----VDEMIMVRDISLTSTCEHHFVTIDGLAHVAYIPRGKVIGLSKINRIVQFFARRPQVQERXXXX
GCH1_SHISS      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SHIFL      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SHIF8      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SHIDS      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SHIBS      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SHIB3      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_RALSO      GFEDPRR--DMVIIRSIAVHGVCPHHLLPFRGVAHVAYLPDGRLHGFGRIARMIDAISHRYTYQEWVTNE
GCH1_ESCF3      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECOUT      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECOSM      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECOSE      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECOLU      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECOLI      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECOLC      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECOL6      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECOL5      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECOK1      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECOHS      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECODH      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECOBW      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECO8A      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECO81      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECO7I      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECO5E      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECO57      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECO55      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECO45      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECO27      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ECO24      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_HAMD5      --------DEMITVHDISLSSTCEHHFASIDGKATVAYIPKDYIIGLSKINRVVQFFSQRPQVQERXXXX
GCH1_YERPY      LIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_YERPG      LIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_YERPE      LIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_YERPB      LIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_YERP3      LIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_ENT38      VIENKMNVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDTVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALTY      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALTI      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALSV      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALPK      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALPC      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALPB      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALPA      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALNS      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALHS      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALEP      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALDC      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALCH      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALAR      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALA4      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_KLEP7      TVIENKKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_KLEP3      TVIENKKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDAVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_YERE8      TLIENKKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_SALG2      NKMKV---DEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDYVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_CITK8      VIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERXXXX
GCH1_BAUCH      --------DEMVTVRNITLTSTCEHHFLMIDGKATVSYIPKSNVIGLSKINRIVRFFAQRPQVQERXXXX
GCH1_BUCAP      LMDNKIKFHEMIIVRDILLISTCEHHFITINGQATIAYIPENKIIGLSKINRIAQFFAKRPQIQERXXXX
GCH1_EUGGR      --------------------SMCEHHMLPFWGKVHIAYIPKGKVLGLSKLARVAEMYARRLQVQERLTRQ
GCH1_BACPU      ----------------------------------------------------------------------
QUEF_TRIEI      -------------EINISLTCKCPFSGYPDFATIHIKYIPNERVVELKAIKLYINSYRERYISHEESVNQ
ACY1_MOUSE      -FKDSEGYQDM---KSVSIQLKSEGHRFP--RTIHMTFVPDEEVGG----HKGMELFVKRPEFQ------
UBID_IDILO      PYGDHTGYYNEVDEFPVFTVTHVTHRKDPIYHSTYTGRPPDEAVLGVA----LNEVFIPLLQKQ------


                         +         .         .         .         .         *         .:210
query           VAQALMTSLDAKGVAVTIDAAHQCMTMRGIKKENATTVTNYFLGEFKKDLSVQNRYLRFISK
GCH1_PELUB      VAQALMTSLDAKGVAVTIDAAHQCMTMRGIKKENATTVTNYFLGEFKKDLSVQNRYLRFISK
GCH1_MARMM      IADALTEAMEPRGVAVLVDAKHQCMTTRGVHHPNVSTITTTFTGEFRNDRDLKDRFMRLLER
GCH1_BRUSU      IADSMQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDFKEKADQQVRFMTLI--
GCH1_BRUSI      IADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDFKEKADQQVRFMTLI--
GCH1_BRUME      IADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDFKEKADQQVRFMTLI--
GCH1_BRUMB      IADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDFKEKADQQVRFMTLI--
GCH1_BRUC2      IADSMQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDFKEKADQQVRFMTLI--
GCH1_BRUAB      IADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDFKEKADQQVRFMTLI--
GCH1_BRUA2      IADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDFKEKADQQVRFMTLI--
GCH1_BRUA1      IADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDFKEKADQQVRFMTLI--
GCH1_BRUO2      IADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDFKEKADQQVRFMTLI--
GCH1_HYPNA      ICDAITESLAPMGTAVFIEAEHQCMSTRGVHHKHVTTITTQFTGVFKSDADLRNRFL-----
GCH1_CAUCR      IADAIEDHLSAAGVAVLIDAEHQCMSTRGVHHHDVSTITTQFRGVFKTDKVLQQRFMDLVKK
GCH1_BARQU      IADALEEYLKPCGIAVLIEAEHMCMTMRGVQKQGATTITTSFHGSYEKDQVAQTNFMMIVRR
GCH1_SINMW      IARAIDETLVPRGVAVMIEAEHLCMAMRGIKKQGAXXXXXXXXGEFKSEPAEQVRFMTML--
GCH1_XYLFM      IAACIQETLSPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTFREDARTRAEFLQFI--
GCH1_BARHE      IANALETHLKPRGVAVLIEAEHMCMTMRGVQKQGAKTITTSFHGSYEKDQVAQAHFMMIVRR
GCH1_XYLFA      IAACIQETLTPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTFREDARTRAEFLQFI--
GCH1_XANCP      IAQCIQDVLQPRGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAEFLQFI--
GCH1_RHISN      IARAIDETLAPRGVAVMIEAEHLCMAMRGIKKHGSXXXXXXXXGAFKTEPAEQARFMTLL--
GCH1_XYLFT      IAACIQDTLTPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTFREDARTRAEFLQFI--
GCH1_XYLF2      IAACIQDTLTPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTFREDARTRAEFLQFI--
GCH1_XANC5      IAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGTFREDARTRAEFLQFI--
GCH1_XANAC      IAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAEFLQFI--
GCH1_RHILO      IAGVIQDVLNPRGVAVMIEAEHMCMAMRGIRKQGSTTLTSTFTGVFKDTPEEQVRFVTMV--
GCH1_RHIME      IAKAIDETLMPRGVAVMIEAEHLCMAMRGIKKQXXXXXXXXXXXXXKSEPAEQVRFMTML--
GCH1_OCHA4      IADSIQRILKPRGVAVMIEAEHMCMAMRGIRKQGSXXXXXXXXGEMQVNAEEQVRFM-----
GCH1_RHOPT      IAAAIDEVLKPRGVAVLLEAEHTCMSVRGIAKKGATTFTSRYTGVFRDNPAEQARFMSMV--
GCH1_RHOPA      IAAAIDEVLKPRGVAVLLEAEHTCMSVRGIAKKGATTFTSRYTGVFRDNPAEQARFMSMV--
GCH1_BARBK      VANSLKKYLKPRGLAVLIEAEHMCMAMRGVQKQGAATITTSFHGYYKKDQVAQANFM-----
GCH1_METS4      IADTIDAVLNPRGVAVMVEAEHLCMAMRGVQKAGVSTLTTQFTGVFKQDPHEQVRFLTLV--
GCH1_RHOP2      IAAAIDEVLKPRGVAVMIEAEHTCMSVRGIGKQGASTFTSRYTGMFRDNPAEQARFMSMI--
GCH1_RHOPS      IAAAIDEVLKPRGVAVMIEAEHTCMSVRGIGKQGASTFTSRYTGMFRDNPAEQARFMSMI--
GCH1_RHOPB      IAAAVDEVLKPRGVAVMIEAEHTCMSVRGIAKQGAVTFTSRFTGMFRDNPAEQARFMSMI--
GCH1_AGRVS      IADSLVQYLQPRGVAVMVDAEHMCMAMRGIQXXXXXXXXXXXXXXXXXDVPQQVRFMTMV--
GCH1_AGRT5      IARSIEETLKPRGVAVMIDAEHMCMSMRGVNKQXXXXXXXXXXXXXKNDPAEQVRFMTMV--
GCH1_AZOC5      ITTALDEALKPRGVAVMIEAEHMCMSMRGILKPGVTTLTSQFTGAFRDDPAEQVRFITML--
GCH1_THEEB      VAEAIETVLDPKGVAVVMEATHMCMVMRGVQKPGSWTVTSSMLGVFREDQKTREEFLNLI--
GCH1_BEII9      IIGAIDEHLQPRGCAIMLEAEHMCMSMRGVQKHGTSTLTTQFTGVFKNDPAEQVRFFGMV--
GCH1_SYNP6      IAESVQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMVGVFQEDQRTREEFLSLI--
GCH1_SYNE7      IAESVQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMVGVFQEDQRTREEFLSLI--
GCH1_MESSB      IAGAIQNVLQPLGVAVMVEAEHMCMAMRGVRKQ-----------------------------
GCH1_BRAJA      IAAAIDEVLKPRGVAVLIEAEHTCMSVRGVAKHGASTFTSRFTGMFRDNPAEQARFLSLV--
GCH1_SYNJB      IAEALMEVLDPYGVGVVIEATHMCMVMRGVQKAGSWTVTSSMVGVFQEDPRTREEFLSLI--
GCH1_RICBR      IAESVQENLKPLGVAVKISALHSCMSMRGVMQDNSIMNTMHYTGIFAEQQKYRHEFLNLTSK
GCH1_RICB8      IAESVQENLKPLGVAVKISALHSCMSMRGVMQDNSIMNTMHYTGIFAEQQKYRHEFLNLTSK
GCH1_RICTY      IAESIQESLKPLGVAIKISAFHSCMSMRGVMHDNSVMNTMYYTGIFAEQQKYRHEFLNFIAK
GCH1_NOSP7      IAEAIQTILEPRGVAVVMEASHMCMVMRGVQKPGSWTVTSAMVGVFQEEHKTREEFFNLI--
GCH11_ANASP     IAEAVQTILEPQGVAVVMEASHMCMVMRGVQKPGSWTVTSAMLGVFQEEQKTREEFFNLI--
GCH1_SYNJA      IAEALMTMLDPYGVGVVIEATHMCMVMRGVQKPGSWTVTSSMVGVFQEDPRTREEFLSLI--
GCH1_CHLTE      IRDAIQNVLNPRGVAVVIEATHMCMVMRGVEKQNAVTTTSAMSGDFMTSQSTRSEFLRLI--
GCH1_CHLCH      IRDAIQNVLNPKGVAVVIEAKHLCMVMRGVEKLNSITTTSAMSGVFMTSPSTRGEFLRLIQK
GCH1_FINM2      IADALMEYLNCKGCLVTIEAEHMCMNMRGVKKPGTSTMTSVARGAFEEDLDLKNEAYRLM--
GCH1_SYNY3      IAEAVQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMIGSFQNEQKTREEFLNLI--
GCH1_RICPR      IAESVQENLKPLGVAVKISALHSCMSMRGVMHDNSVMNTMYYTGIFAEQQKYRYEFLNLIAK
GCH1_CLOPE      IADSIMEYLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKFLEDESLKNDVFRMIS-
GCH1_PROVI      IRDAIQDVLHPKGVGVVIEAKHMCMVMRGVEKLNSVTTTSAMSGEFISSESTRGEFLRLI--
GCH1_CLOPS      IADSIMEYLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKFLEDESLKNDVFRMIS-
GCH1_GLOVI      IAEALQEVLQPRGVAVVIEASHMCMVMRGVQKPNSWTVTSSMVGVFKESQSTRQEFLDLI--
GCH1_CLOP1      IADSIMEYLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKFLEDESLKNDVFRMIS-
GCH1_RICFE      IAESVQENLKPLGVAVKISALHSCMSMRGVMQDNSVMNTMHYTGIFAEQQKYRYDFLNLTAK
GCH1_CAEEL      IATAMVQAVQPSGVAVVIEASHMCMVMRGVQKINASTTTSCMLGVFRDDPKTREEFLNLINK
GCH1_CAMJ8      IAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFFSLIN-
GCH1_CAMJR      IAQALMENVDAKGVGVVIEARHMCVEMRGIQKANSTTTTSALRGIFLKNEKTREEFFSLIN-
GCH1_RICAH      IAESVQENLKPLGVAVKIAALHSCMSMRGVMQDHSIMNTMHYTGIFAEQQKYRHEFLNLTTK
GCH12_ANASP     IADALQGLLKPQGVAVVIEATHMCMVMRGVQKPGSWTVTSAMRGVFAEDARTREEFMNLV--
GCH1_CAMJE      IAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFFSLIN-
GCH1_CAMJD      IAQALMENADAKGVGVIIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKIREEFFSLIN-
GCH1_CORGL      IADALVEKLDAQAVAVVIEAEHLCMAMRGIRKPGAVTTTSAVRGGFKNN-------------
GCH1_COXBU      IAEAILTATEAKGVGVIIEAKHLCMMMRGVEKQNSEMTTSVMLGTFRKDDRTRSEFLSLIRK
GCH1_COXBR      IAEAILTATEAKGVGVIIEAKHLCMMMRGVEKQNSEMTTSVMLGTFRKDDRTRSEFLSLIRK
GCH1_COXBN      IAEAILTATEAKGVGVIIEAKHLCMMMRGVEKQNSEMTTSVMLGTFRKDDRTRSEFLSLIRK
GCH1_CLOK5      IADSIMDYLKVKGVMVVIEAEHMCMTMRGIKKPGSKTVTVATRGIFKNKIEFRNQVYEMI--
GCH1_CLOK1      IADSIMDYLKVKGVMVVIEAEHMCMTMRGIKKPGSKTVTVATRGIFKNKIEFRNQVYEMI--
GCH1_CAMJJ      IAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFFSLIN-
GCH1_BACA2      IAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGIFKDDAAARSEVLEHIKR
GCH1_BACSU      IAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGVFKDDAAARAEVLEHIKR
GCH1_CORGB      IADALVEKLDAQAVAVVIEAEHLCMAMRGIRKPGAVTTTSAVRGGFKNN-------------
GCH1_CHICK      IAIAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTATSTMLGVFREDPKTREEFLTLI--
GCH1_RAT        IAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI--
GCH1_RICPU      IAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQKYRHEFLNFTAK
GCH1_RICM5      IAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQKYRHEFLNLTAK
GCH1_WOLSU      IADTLMEVLQPKGAMVVAEATHMCMVMRGVEKQQSVMVTSAVRGLFKRDARTREEFMGHI--
GCH1_DICDI      IAQAIQAHLNPMGVAVVIEASHMCMVMRGVQKPGASTVTSSVCGIFEKDSRTRAEFFSLI--
GCH1_SCHPO      VAQAIQAVLKPQGVAVVMEATHMCMVMRGVEKPGSSTVTSSLTGIFQRSHKTREEFFRLIGK
GCH1_RICAE      IAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQKYRHEFLNLTAK
GCH1_STRSY      VAHALQDALEPEGVFVMVEAEHMCMSMRGIRKPGSKTVTTVALGKYKEDAILRRELLSMI--
GCH1_STRS2      VAHALQDALEPEGVFVMVEAEHMCMSMRGIRKPGSKTVTTVALGKYKEDAILRRELLSMI--
GCH1_RICRS      IAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQKYRHEFLNLTAK
GCH1_RICRO      IAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQKYRHEFLNLTAK
GCH1_RICCN      IAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQKYRHEFLNLTAK
GCH1_STRAW      VADSLMEILEPRGVIVVVECEHMCMSMRGVRKPGAKTITSAVRGQL-RDPATRNEAMSLI--
GCH1_BACAH      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARNEILSFI--
GCH1_STRPN      VADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLM--
GCH1_STRPJ      VADALMEYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLM--
GCH1_STRP7      VADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLM--
GCH1_STRP4      VADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLM--
GCH1_STRR6      VADALMDYLGAKGAFVIIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLM--
GCH1_STRP2      VADALMDYLGAKGAFVIIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLM--
GCH1_CAMC5      IAQALAEVIEPKGVGVVVEARHMCVEMRGVQKINSTTTTSALRGCFIKNADTRREFFSLIN-
GCH1_AZOVD      IAEAVEQVTGASGVGVVIEAQHMCMMMRGVEKQNSTLVTSVMLGHFRSNTATRSEFLSLI--
GCH1_PORGI      IKECIQNTLNPLGVIVVIEAQHMCMQMRGVEKQNSLTTTSDFTGAFEES-TTREEFLNLIGR
GCH1_PORG3      IKECIQNTLNPLGVIVVIEAQHMCMQMRGVEKQNSLTTTSDFTGAFEES-TTREEFLNLIGR
GCH1_LEPIN      IAYAIQEVLDPQGVAVVIKAKHLCMMMRGVEKQNSELFTSCMLGAFKENMVTRSEFLDLI--
GCH1_LEPIC      IAYAIQEVLDPQGVAVVIKAKHLCMMMRGVEKQNSELFTSCMLGAFKENMVTRSEFLDLI--
GCH1_LEPBL      IAYAVQEVLDPQGVAVVIKAKHLCMMMRGVEKQNSELFTSCLLGAFKENMVTRSEFLDLI--
GCH1_LEPBJ      IAYAVQEVLDPQGVAVVIKAKHLCMMMRGVEKQNSELFTSCLLGAFKENMVTRSEFLDLI--
GCH1_STRMU      IANALEEALKPKGVLVMIEAEHMCMTMRGIKKPGSKTVTRVVRGICQSDKETRQEIIAMI--
GCH1_STRCO      IADSLMEILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSAVRGQL-RDVATRNEAMSLI--
GCH1_MYCVP      IADALMRRLDPRGVIVVIEAEHLCMAMRGIRKPGAVTTTSAVRGQFKTD-------------
GCH1_MYCGI      IADALMRKLDPRGAIVVIEAEHLCMAMRGIRKPGAVTTTSAVRGQFKTD-------------
GCH1_MOUSE      IAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI--
GCH12_PSEAE     IAEAVQQVTGALGVAVVIQAQHMCMMMRGVEKQNSSMVTSVMLGEFRDNAATRSEFLSLI--
GCH1_STRPY      IADALVEALHPTGVLVLVEAEHMCMTMRGIKKPGSKTITTTARGLYKEDRSERQEVMALMTK
GCH1_CARHZ      IADAIMEKLNPRGVLVVIEAEHMCMTMRGVKKPGSKTITSAVRGIFATSVATRAEAMALI--
GCH1_BACWK      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_BACHK      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_BACCZ      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_BACCR      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_BACCQ      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_BACC7      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_BACC4      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_BACC3      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_BACC2      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_BACC1      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_BACC0      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_BACAN      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_BACAC      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_BACAA      VANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH12_PSEPK     IAYAVQEVTDAAGVGVVIEAKHMCMMMRGVEKQNSVMISSVMLGAFRDAPSTRHEFLNLIGR
GCH1_THEFY      VADALMERLEPRGVIVVVEAEHLCMTMRGVRKPGAKTVTSAVRGAFRE--------------
GCH1_STRZP      VADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLM--
GCH1_STRZJ      VADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLM--
GCH1_STRPS      VADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLM--
GCH1_STRPI      VADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLM--
GCH1_STRZT      VADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLM--
GCH1_METCA      IADAIQTAVNPRGVAVVVEAKHLCMMMRGVEKQNSVMTTSSMLGLFRKQSSTRAEFLDLIGR
GCH1_BACP2      IADSMVETLNPHGVMIVVEAEHMCMTMRGVKKPGAKTVTSAVRGTFANDAAARAEVLSFI--
GCH1_ALHEH      IALAVQQVTGGKGVAVYINARHLCMMMRGVEKQNSEMSTSVMLGDFRENPKTRNEFLQLI--
GCH1_STRGG      IAESLMSILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSAVRGQLR---------------
GCH1_BACCN      VADSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARSEILSFI--
GCH1_PARD8      IKDCIQRTLDPLGVMVVIEAQHMCMQMRGVEKQNSLTTTSDFTGFFQQ--------------
GCH1_JANMA      IADTLMEHVQPLSVGVVIRCRHMCMESRGIRTPGEETVTSALLGEMRTNLGLRNEFL-----
GCH1_COREF      IADALVDKLGAQSVAVVIEAEHLCMGMRGIRKPGAVTTTSAVRGGFKTSMA-----------
GCH1_STRA5      VAQALEDALAPKGIFVMIEAEHMCMTMRGIKKPGSKTITTVARGLYKDDRYERQEILSLIQK
GCH1_RHOBA      VANLIEDRLSARGVAVVVESTHSCMTMRGIRKPGSLCLTSAMRGAFKTDPKSRAEVLGLINR
GCH1_CAMLR      IAEALMEHVGAKGVGVVIEARHMCVEMRGVQKANSTTSTSALRGSFLKSEKTRKEFFTLIN-
GCH1_STRA1      VAQALEDALAPKGIFVMIEAEHMCMTMRGIKKPGSKTITTVARGLYKDDRYERQEILSLIQK
GCH1_HUMAN      IAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI--
GCH1_DESRM      IADAIMKRLNPYGVVVVVEAEHLCMSMRGVRSPGARTVTSAVRGIFKKNEASRAEAMSLIMK
GCH1_OSTOS      IATXXXXXXXXXXXXXXIEASHMCMVMRGVQKINATTSTSCMLGVFRDDPKTREEFLNLIHK
GCH1_CAMC1      IAKALEDVIAPKGVGVVVEARHMCVEMRGVEKINSTTTTSALRGCFIKNADTRREFFSLIN-
GCH1_LEPBP      IAQAIQETLDPLGVGVVIKAKHLCMMMRGVEKQNSELFTSSLLGLFKTDPTTRSEFLDLI--
GCH1_LEPBA      IAQAIQETLDPLGVGVVIKAKHLCMMMRGVEKQNSELFTSSLLGLFKTDPTTRSEFLDLI--
GCH11_PSEAE     IAEAVRQVTSAAGVAVVIEAQHMCMMMRGVEKQNSQMFTSVMLGAFRDSNTTRQEFLQLIGR
GCH1_STRPG      IADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAERQEVISLMTK
GCH1_STRP8      IADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAERQEVISLMTK
GCH1_STRP6      IADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAERQEVISLMTK
GCH1_STRP3      IADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAERQEVISLMTK
GCH1_STRP1      IADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAERQEVISLMTK
GCH1_MYCA9      IADALVRKLEPRGVIVVVEAEHLCMAMRGVRKPGATTTTSAVRGQFKRD-------------
GCH1_STRPZ      IADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAERQEVISLMTK
GCH1_STRA3      VAQALEDALAPKGIFVMIEAEHMCMTMRGIKKPGSKTITTVARGLYKDDRYERQEILSLIQK
GCH1_PELTS      IADTIMRRLNPIGVLVVIEAEHMCMTFRGVKKPGSKTVTSAVRGLFRKNVATR---------
GCH1_CORA7      IADALVEVLHAQSVIVVIECEHLCMAMRGIRKPGATTTTSAVRGGFKKNAASRAEVMSLI--
GCH1_LYSSC      VADTIMEMLAPKGVYVVIEAEHMCMTMRGLKKPGSKTVTSVARGVYEEDEVKRREVLSFI--
GCH1_BREBN      VADSIMRKLDPHGVVVVVEAEHMCMTMRGVKKPGSKTITSAVRGMFEKDAAAR---------
GCH1_THEPX      IADTIMEAVNPLGVAVVIEAEHLCMTMRGIKKPGAKTVTSALRGIFRTD-------------
GCH1_THEP3      IADTIMEAVNPLGVAVVIEAEHLCMTMRGIKKPGAKTVTSALRGIFRTD-------------
GCH1_STRT2      VATALEEALNPRGVFVMVEAEHMCMTMRGIKKPGSKTITTVAKGIYKED-------------
GCH1_STRT1      VATALEEALNPRGVFVMVEAEHMCMTMRGIKKPGSKTITTVAKGIYKED-------------
GCH1_GEOSW      VADSIMETLDPYGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVFETDQVARAEVLSLI--
GCH1_BACHD      VADALVETLEPHGVIVVVEAEHMCMTMRGVKKPGAATVTSAVRGTFANDAAARAEVLSLI--
GCH1_BACFR      IKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSVTTTSDFTGAFNQ--------------
GCH1_BACFN      IKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSVTTTSDFTGAFNQ--------------
GCH1_THETN      IADTIMEAVNPLGVAVVIEAEHLCMTMRGVKKPGSKTVTSALRGIFRTDQKARAEVMALIN-
GCH1_YEAST      IAMALSDILKPLGVAVVMEASHMCMVSRGIQKTGSSTVTSCMLGGFR---------------
GCH1_GEOKA      IADSIVEALEPHGVMVVVEAEHMCMTMRGVKKPGSKTVTTAVRGVFETDANARAEVLSLI--
GCH1_BACTN      IKDCIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSITTTSDFTGAFNQ--------------
GCH1_DEHSC      IADAIMDGLKCDGVAVVIEAEHMCMVMRGIKKPGSRVITSALRGSFHKSPAARAEFLSLI--
GCH1_DEHSB      IADAIMDGLKCDGVAVVIEAEHMCMVMRGIKKPGSRVITSALRGSFHKSPAARAEFLSLI--
GCH1_CLOD6      AADIIMEELQPYGVLVVVEAEHMCMTMRGVKKPGSKTVTSAVRGIFEKDIASRAEAMSLIT-
GCH1_STRGC      IATALDEALSPEGVFVMVEAEHMCMTMRGIKKPGSKTITTVAKGIYKENVHQRQEILSMI--
GCH1_CHRSD      IAEAVQQVTQARGVGVIIEAQHMCMMMRGVEKQNSSMKTSVMLGAFRNNLTTRQEFLTLV--
GCH1_NEUCR      VANAIMEILKPQGVAVVMESSHLCMVMRGVQKTTSSTITSCVLGCFESREKTRLEFLSLI--
GCH1_MYCTU      IADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLFKTNAASRAEALDLI--
GCH1_MYCTA      IADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLFKTNAASRAEALDLI--
GCH1_MYCBT      IADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLFKTNAASRAEALDLI--
GCH1_MYCBP      IADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLFKTNAASRAEALDLI--
GCH1_MYCBO      IADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLFKTNAASRAEALDLI--
GCH1_DEHE1      IADAIIDGLKCDGVAVVIEAEHMCMVMRGIKKPGSRVITSALRGSFHKSPAARAEFLSLIQQ
GCH1_MYCLE      IADALVSKLDPRGVIIVVEAEHLCMAMRGVRKPGAITTTSAVRGQFKTDAASRAEALGLI--
GCH1_MYCLB      IADALVSKLDPRGVIIVVEAEHLCMAMRGVRKPGAITTTSAVRGQFKTDAASRAEALGLI--
GCH1_CLOTH      VANVIMESINPLGVAVVVEAEHLCMTMRGIKKAGSKTVTSALRGIIKTDARTRAEVMALIN-
GCH1_SULSY      IAEYLEKELQPKGVAVVMEAVHLCMAMRGVRNPESITVTSKLTGRFLECQKTREEFLNLIN-
GCH1_PERMH      IAEFLEKELSPKGVAVVLEAEHLCMSMRGVKNPTSYTITSKLTGAFMEDEKTRNEFLNLI--
GCH1_NITMU      VAQSLLEHLQPKAVGVILRCRHMCMESRGIAVAGEETVTSAMLGDLKTNAAQRAEFL-----
GCH1_MYCPA      IADALVKKLNPRGVIVVVEAEHLCMAMRGVRKPGAVTTTSAVRGLFKTNAASRAEALDLI--
GCH1_LISW6      VAEIMMDKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRSEVLALI--
GCH11_PSESM     IADSIQQVTXXXXXXXXIEAQHMCMMMRGVEKQNSTMNTSVMLGAFRESSTTRMEFLQLIGR
GCH1_THEYD      LANLLMEKLKPKGCMVVIEAEHLCMSMRGIKKPDAKTITSAVRGIFRKSQTTRQEALELINR
GCH1_MYCA1      IADALVKKLNPRGVIVVVEAEHLCMAMRGVRKPGAVTTTSAVRGLFKTNAASRAEALDLI--
GCH1_LISMO      VAEIMMEKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRSEVLALI--
GCH1_LISMH      VAEIMMDKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRSEVLALI--
GCH1_LISMF      VAEIMMEKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRSEVLALI--
GCH1_LISMC      VAEIMMEKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRSEVLALI--
GCH1_LISIN      VAEIMMDKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRSEVLALI--
GCH1_BIFLD      IADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRG------------------
GCH1_PSEA6      IADAIQEVTGAAGVGVIMEGKHMCMMMRGVQKQNSSMVTSVMLGAMRKSDATRNEFLRLIGK
GCH1_STRSV      IAEALMDYLGAQGALVWVEAEHMCMNMRGVRK------------------------------
GCH1_DEIRA      VADAVEELLAPKGVAVLMEGIHLCMAMRGVQKQNSSTTTSAMRGLFRSD-------------
GCH1_CLONN      IADSLMEYLKCKGAMVIIEAEHLCMSMRGVKKWGSKTTTIVTRGEFQKDNSLKQDVLNIL--
GCH1_ONCMY      IAVAITEALQPAGVGVVIEATHMCMVMRG---------------------------------
GCH1_PSEHT      IAKXXXXXXXXXXXXXXXXXKHMCMMMRGVEKQNSSMRTSVMLGNFRADPKTRNEFLQLI--
GCH1_HELPY      IAETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKKDSKTRAEFMQLL--
GCH1_HELP2      IAETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKKDPKTRAEFMQLL--
GCH1_BIFLO      IADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRG------------------
GCH1_AQUAE      IADFLEKELEPKGVGVVIEAEHLCMSMRGVMSPGHLTVTSALRGVFLKDIKTREEFLKLV--
GCH1_HELPJ      IAETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKKDPKTRAEFMQLL--
GCH1_HELPG      IAETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKKDPKTRAEFMQLL--
GCH1_HAHCH      IAEAVLEVTNAHGVGVIIEARHMCMMMRGVEKQNXXXXXXXXLGSMRNNPSTRSEFLTLV--
GCH12_PSESM     IAEXXXXXXXXXXXXXXXEAKHMCMMMRGVEKQNSAMITSVMLGEFRENAATRSEFLSLI--
GCH1_MYCUA      IADALVKRLGPRGVLVVVEAEHLCMAMRGVRKPGAVTTTSAVRGQFKTDAASRAEALDLI--
GCH1_MYCMM      IADALVKRLGPRGVIVVVEAEHLCMAMRGVRKPGAVTTTSAVRGQFKTDAASRAEALDLI--
FOLKE_LACLA     IGDILTDILNPKGVAVLVEGRHMCVEMRGVKKVNSITKTSYFLGEFKENNEKRMEFL-----
GCH1_HELPS      IAETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLKGLFKKDPKTRAEFMQLL--
GCH1_FLAJ1      IVQELQKALGTEDVACVIDAKHLCVNSRGIKDIESSTVTSEFGGKF-KDPQTKREFLDYI--
GCH1_HELPH      ITETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKKDPKTRAEFMQLL--
FOLKE_LACLM     IADILTDILKPKGVAVLVEGRHMCVEMRGVKKVNSLTKTSYFLGEFKEN-------------
GCH1_TERTT      VASTIAEVTGAAGVGVIIEAKHLCMMMRGVEKQNSVMKTSAMLGSFRANLSTRSEFLALLN-
GCH1_LACPL      IATELQRILDPAGIAVSITARHMCMEMRGVSKPGVHTESSYYSGQFKTDLDLKREFLQRIAK
GCH11_PSEPK     IXXXXXXXXXXXXXXXXXXXKHMCMMMRGVEKQNSTMITSVMLGEFRDNAATRSEFLSLI--
GCH1_DROME      IXXXXXXXXXXXXXXXXXXXXHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREEFLNLVN-
GCH1_CLOAB      IAEIMEKVTASKDIAVIIKGEHGCMTSRGIKKPGALTTTMTLKGRFKNDDSLVTKLM-----
GCH1_HYDS0      IADIVQKELEPMGVGVVIEAEHLCMSMRGVRSPGHCTVTSSLRGNFLSDIRTKEEFFKLI--
GCH1_HELAH      IAETFDEIIEPRGVIVICEAKHLCMSMQGVQKQNAIIKTSALKGLFKKDPKTRAEFMQLL--
GCH1_HYPBU      IADEISKATGSPDVMVITEAVHLCMAMRGV-RNGAPTVVAAVRGEFERDQSLKEEVYRII--
GCH1_ENTFA      IARKLQENIPVKGIAVAIEAEHMCMTMRGVKTPQSSTKTFQFTGLFKE--------------
GCH1_FUSNN      IAKYIYEILNCQGVYVVVEAKHLCVTMRGQKKENTKILTTSAKGVFETD-------------
GCH1_LEIXX      IADTFEAGAGARGVLVVLSAEHGCVTARGPRQVAATTVTLAARGEF----------------
GCH1_LACSS      IGQILNQILKPYGVAVQVTARHMCVEMRGIKKANSQTHTTFYSGNFKTDRQLRSEFLQLL--
GCH1_HELHP      IADALIAELKPKGAMIVCQARHLCLEMRS-NVPQSHIITSALRGLFKKDSRTRAEFMQIL--
GCH1_CLOCE      IAEIMQKITDSEDVAVIVEGQHACMTTRGIKNTGSRXXXXXLRGAFKTDTNLTNRLM-----
GCH1_CLOB8      IAEIVSMVTKSSDVGVLITGEHGCMTSRGIKKPGXXXXXXXXXGKFQ---------------
GCH1_SULTO      IADAIMNSIHPKGVMVIGDALHMCAYVRGVKDREASLLSVATRGLFKNNVSLRNYVFRLL--
GCH1_CALMQ      IMNEVSSATGSGDVMVLTEAYHTCMMIRGVRSA-SPLVSMAYKGKF-NDSSLRLEFLEYI--
GCH1_SULIN      IADAIMNSIKPKGVMVIGNAIHMCSYVRGVKDKEAKLVSVAYRGLFKTNRALQNHVFRLL--
GCH1_SULSO      IADAIMNSIKPKGVMVIGNAIHMCSYVRGVKDKEAKLVSVAYRGLFKTNRALQNHVFRLL--
GCH1_SULIY      IADAIMNSIKPKGVMVIGNAIHMCSYVRGVKDKEAKLVSVAYRGLFKTNRALQNHVFRLL--
GCH1_SULIM      IADAIMNSIKPKGVMVIGNAIHMCSYVRGVKDKEAKLVSVAYRGLFKTNRALQNHVFRLL--
GCH1_SULIL      IADAIMNSIKPKGVMVIGNAIHMCSYVRGVKDKEAKLVSVAYRGLFKTNRALQNHVFRLL--
GCH1_SULIK      IADAIMNSIKPKGVMVIGNAIHMCSYVRGVKDKEAKLVSVAYRGLFKTNRALQNHVFRLL--
GCH1_SULIA      IADAIMNSIKPKGVMVIGNAIHMCSYVRGVKDKEAKLVSVAYRGLFKTNRALQNHVFRLL--
GCH1_SULAC      IAEAIMKSIQPKGVMVIGDALHMCTYVRGVKDREASLISLSTRGIFSTKPSLKSQVFRLIN-
GCH1_VIBCH      ILVALQTLLESDDVAVTIDATHYCVKSRGVMDATSVTTTTALGGIFKSNPATRAEFL-----
GCH1_CLOB6      IAEILKMITDSEDVAVIIEGEHGCMXXXXXXXXXXXXXXXXXXXKFNTDTIVSNKLMMLYTK
GCH1_CLOBL      IAEILQKVTDSEDVAVIIEGEHGCMXXXXXXXXXXXXXXXXXXXXFNTDPIVSNKLMMLYTK
GCH1_CLOBK      IAEILQKITDSEDVAVIIEGEHGCMXXXXXXXXXXXXXXXXXXXXFNTDPIVSNKLMMLYTK
GCH1_CLOBH      IAEILQKITDSEDVAVIIEGEHGCMXXXXXXXXXXXXXXXXXXXXFNTDPIVSNKLMMLYTK
GCH1_CLOB1      IAEILQKITDSEDVAVIIEGEHGCMXXXXXXXXXXXXXXXXXXXXFNTDPIVSNKLMMLYTK
GCH1_CLOBJ      IAEILQKITGSEDVAVIIEGEHGCMXXXXXXXXXXXXXXXXXXXXFNTDPIVSNKLMMLYTK
GCH1_PHYBL      VATALMEILQPQGVAVVVECSHLCMVMRG---------------------------------
GCH1_HAEDU      ILTAFQTILETEDVAIYVKATHFCVKCRGIKDSNSYTVTSAFGGVFLDDRETRKEFLNLIHK
GCH1_MANSM      ILLAFQTILETEDVAVYMKATHFCVKCRGIKDTNSYTVTSAFGGVFLEDRETRKEFLSLINK
GCH1_ACTPJ      ILTAFQTILETDDVAVFVKATHFCVKCRGVKDTNSYTVTSAFGGVFLEDRETRKEFLGLINK
GCH1_ACTP7      ILTAFQTILETDDVAVFVKATHFCVKCRGVKDTNSYTVTSAFGGVFLEDRETRKEFLGLINK
GCH1_ACTP2      ILTAFQTILETDDVAVFVKATHFCVKCRGVKDTNSYTVTSAFGGVFLEDRETRKEFLGLINK
GCH1_VIBHB      ILVALQTLLESDDVAVTIDATHYCVKSRGVMDATSETTTTALGGIFKSNPATRAEFL-----
GCH1_CLOBM      IAEILQKITGSEDVAVIIEGEHGCMXXXXXXXXXXXXXXXXXXXXFNTDPIISNKLMMLYTK
GCH1_HAES2      ILLAFQTILETEDVAVYVKATHFCVKCRGIKDTNSYTVTSAFGGVFLDDRETRKEFLTLLKK
GCH1_HAES1      ILLAFQTILETEDVAVYVKATHFCVKCRGIKDTNSYTVTSAFGGVFLDDRETRKEFLTLLKK
GCH1_EDWI9      ILVALQTLLGTKNVAVSIDAVHYCVKARGVRDXXXXXXXXXXXXXFKTSQNTRQEFLRAV--
GCH1_PASMU      ILLAFQTILETDDVAVYVKATHFCVKCRGIKDTNSYTVTSAFGGVFLDDRETRKEFLTLINK
GCH1_ERWT9      ILVALQTLLGTSNVAVSIDAVHYCVKARGIRDXXXXXXXXXXXXXFKSSQNTRQEFLRSV--
GCH1_BLOFL      IFLALQTLLNTNNVAIFINAVHYCVKARGIHDMTSTTNTTALGGLFKSNKSIRKEFLHTIT-
GCH1_TOLAT      ILVALQVLLGTDNVAITVTATHYCVKSRGVMDASSQTTTTALGGVFKSSAATRHEFL-----
GCH1_HAEIE      LLTAFQTILETDDVAVYVKATHFCVKARGIRDTNSYTVTSAYGGVFLEDRDTRKEFLATVQK
GCH1_HAEI8      LLTAFQTILETDDVAVYVKATHFCVK