[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ22059.1

[Show Plain Result]


## Summary of Sequence Search
    1::189
    4::205     6e-19  35%  231 aa  NQO2_RAT RecName: Full=Ribosyldihydronicotinamide dehydrogenase
    5::184     2e-18  32%  202 aa  Y1544_HAEIN RecName: Full=Uncharacterized NAD(P)H oxidoreductase
    4::202     3e-17  29%  231 aa  NQO2_PONAB RecName: Full=Ribosyldihydronicotinamide dehydrogenase
    4::202     4e-17  29%  231 aa  NQO2_HUMAN RecName: Full=Ribosyldihydronicotinamide dehydrogenase
   13::216     2e-15  27%  275 aa  NQO1_CAVPO RecName: Full=NAD(P)H dehydrogenase [quinone] 1;        
    4::215     5e-15  26%  274 aa  NQO1_PONAB RecName: Full=NAD(P)H dehydrogenase [quinone] 1;        
    3::215     3e-14  26%  274 aa  NQO1_RAT RecName: Full=NAD(P)H dehydrogenase [quinone] 1;       
    4::215     6e-14  26%  274 aa  NQO1_MOUSE RecName: Full=NAD(P)H dehydrogenase [quinone] 1;        
    4::127     6e-13  31%  231 aa  NQO2_MOUSE RecName: Full=Ribosyldihydronicotinamide dehydrogenase
    4::215     7e-12  25%  274 aa  NQO1_HUMAN RecName: Full=NAD(P)H dehydrogenase [quinone] 1;        
    4::112     2e-08  30%  196 aa  YCAK_ECOLI RecName: Full=Uncharacterized NAD(P)H oxidoreductase
   88::142     2e-07  38%  202 aa  AZOR_BEII9 RecName: Full=FMN-dependent NADH-azoreductase;       
   14::159     2e-07  29%  197 aa  AZOR_MYCGA RecName: Full=FMN-dependent NADH-azoreductase;       
   16::197     1e-06  29%  198 aa  AZOR_CLOB8 RecName: Full=FMN-dependent NADH-azoreductase;       
    1::140     2e-06  32%  198 aa  AZOR_SHEON RecName: Full=FMN-dependent NADH-azoreductase;       
   22::138     2e-06  31%  198 aa  AZOR_CLOPS RecName: Full=FMN-dependent NADH-azoreductase;       
   22::138     2e-06  31%  198 aa  AZOR_CLOP1 RecName: Full=FMN-dependent NADH-azoreductase;       
    1::142     2e-06  33%  211 aa  AZOR3_BACHD RecName: Full=FMN-dependent NADH-azoreductase 3;       
   83::157     3e-06  37%  192 aa  AZOR1_COLP3 RecName: Full=FMN-dependent NADH-azoreductase 1;       
    1::140     3e-06  33%  198 aa  AZOR_SHESR RecName: Full=FMN-dependent NADH-azoreductase;       
    1::140     3e-06  33%  198 aa  AZOR_SHESM RecName: Full=FMN-dependent NADH-azoreductase;       
   22::138     3e-06  32%  198 aa  AZOR2_CLOPE RecName: Full=FMN-dependent NADH-azoreductase 2;       
   85::139     6e-06  38%  201 aa  AZOR_BRASB RecName: Full=FMN-dependent NADH-azoreductase;       
    1::139     7e-06  28%  199 aa  AZOR_MYCS5 RecName: Full=FMN-dependent NADH-azoreductase;       
    1::140     1e-05  32%  198 aa  AZOR_SHESA RecName: Full=FMN-dependent NADH-azoreductase;       
   64::176     1e-05  30%  208 aa  AZOR_RALSO RecName: Full=FMN-dependent NADH-azoreductase;       
   41::135     1e-05  31%  195 aa  AZOR_FRAP2 RecName: Full=FMN-dependent NADH-azoreductase;       
    1::142     1e-05  33%  211 aa  AZOR_BACP2 RecName: Full=FMN-dependent NADH-azoreductase;       
   91::135     1e-05  33%  219 aa  AZOR2_COLP3 RecName: Full=FMN-dependent NADH-azoreductase 2;       
   79::137     1e-05  34%  195 aa  AZOR_VIBVU RecName: Full=FMN-dependent NADH-azoreductase;       
   21::141     1e-05  26%  202 aa  AZOR_MYCMO RecName: Full=FMN-dependent NADH-azoreductase;       
   15::205     1e-05  24%  208 aa  AZOR1_BACLD RecName: Full=FMN-dependent NADH-azoreductase 1;       
   80::150     2e-05  34%  193 aa  AZOR_PELUB RecName: Full=FMN-dependent NADH-azoreductase;       
   14::142     2e-05  30%  201 aa  AZOR_COPPD RecName: Full=FMN-dependent NADH-azoreductase;       
   79::137     2e-05  34%  195 aa  AZOR_VIBVY RecName: Full=FMN-dependent NADH-azoreductase;       
   87::141     2e-05  36%  203 aa  AZOR_RHOFD RecName: Full=FMN-dependent NADH-azoreductase;       
    1::176     2e-05  33%  211 aa  AZOR_GEOKA RecName: Full=FMN-dependent NADH-azoreductase;       
   62::197     3e-05  30%  206 aa  AZOR_RHISN RecName: Full=FMN-dependent NADH-azoreductase;       
   88::142     3e-05  38%  199 aa  AZOR_AZOVD RecName: Full=FMN-dependent NADH-azoreductase;       
   82::141     4e-05  32%  202 aa  AZOR_PSEA6 RecName: Full=FMN-dependent NADH-azoreductase;       
   88::142     4e-05  38%  199 aa  AZOR2_PSEPK RecName: Full=FMN-dependent NADH-azoreductase 2;       
   45::99      5e-05  38%  176 aa  KEFF_SHISS RecName: Full=Glutathione-regulated potassium-efflux
   11::139     5e-05  31%  197 aa  AZOR_SHEDO RecName: Full=FMN-dependent NADH-azoreductase;       
   83::144     5e-05  31%  196 aa  AZOR_RHOSK RecName: Full=FMN-dependent NADH-azoreductase;       
   83::144     5e-05  31%  196 aa  AZOR_RHOS4 RecName: Full=FMN-dependent NADH-azoreductase;       
   83::144     5e-05  31%  196 aa  AZOR_RHOS1 RecName: Full=FMN-dependent NADH-azoreductase;       
   12::176     5e-05  34%  211 aa  AZOR_BACST RecName: Full=FMN-dependent NADH-azoreductase;       
   22::107     5e-05  34%  200 aa  AZOR2_CLOAB RecName: Full=FMN-dependent NADH-azoreductase 2;       
   45::88      6e-05  39%  176 aa  KEFF_ENT38 RecName: Full=Glutathione-regulated potassium-efflux
   86::140     6e-05  35%  198 aa  AZOR_SHEB9 RecName: Full=FMN-dependent NADH-azoreductase;       
   86::140     6e-05  35%  198 aa  AZOR_SHEB8 RecName: Full=FMN-dependent NADH-azoreductase;       
   86::140     6e-05  35%  198 aa  AZOR_SHEB2 RecName: Full=FMN-dependent NADH-azoreductase;       
    1::142     6e-05  33%  211 aa  AZOR2_BACSU RecName: Full=FMN-dependent NADH-azoreductase 2;       
    6::104     8e-05  34%  183 aa  KEFG_SALTY RecName: Full=Glutathione-regulated potassium-efflux
    6::104     8e-05  34%  183 aa  KEFG_SALTI RecName: Full=Glutathione-regulated potassium-efflux
    6::104     8e-05  34%  183 aa  KEFG_SALSV RecName: Full=Glutathione-regulated potassium-efflux
    6::104     8e-05  34%  183 aa  KEFG_SALPK RecName: Full=Glutathione-regulated potassium-efflux
    6::104     8e-05  34%  183 aa  KEFG_SALPC RecName: Full=Glutathione-regulated potassium-efflux
    6::104     8e-05  34%  183 aa  KEFG_SALPB RecName: Full=Glutathione-regulated potassium-efflux
    6::104     8e-05  34%  183 aa  KEFG_SALPA RecName: Full=Glutathione-regulated potassium-efflux
    6::104     8e-05  34%  183 aa  KEFG_SALNS RecName: Full=Glutathione-regulated potassium-efflux
    6::104     8e-05  34%  183 aa  KEFG_SALHS RecName: Full=Glutathione-regulated potassium-efflux
    6::104     8e-05  34%  183 aa  KEFG_SALEP RecName: Full=Glutathione-regulated potassium-efflux
    6::104     8e-05  34%  183 aa  KEFG_SALDC RecName: Full=Glutathione-regulated potassium-efflux
    6::104     8e-05  34%  183 aa  KEFG_SALCH RecName: Full=Glutathione-regulated potassium-efflux
    6::104     8e-05  34%  183 aa  KEFG_SALA4 RecName: Full=Glutathione-regulated potassium-efflux
    7::93      8e-05  34%  184 aa  KEFG_CITK8 RecName: Full=Glutathione-regulated potassium-efflux
   45::88      8e-05  36%  176 aa  KEFF_SHIFL RecName: Full=Glutathione-regulated potassium-efflux
   45::88      8e-05  36%  176 aa  KEFF_SHIF8 RecName: Full=Glutathione-regulated potassium-efflux
   45::88      8e-05  36%  176 aa  KEFF_SHIDS RecName: Full=Glutathione-regulated potassium-efflux
   45::88      8e-05  36%  176 aa  KEFF_SHIBS RecName: Full=Glutathione-regulated potassium-efflux
   45::88      8e-05  36%  176 aa  KEFF_SHIB3 RecName: Full=Glutathione-regulated potassium-efflux
   45::88      8e-05  36%  176 aa  KEFF_ECOLC RecName: Full=Glutathione-regulated potassium-efflux
   85::139     8e-05  40%  204 aa  AZOR_THIDA RecName: Full=FMN-dependent NADH-azoreductase;       
   79::142     8e-05  34%  202 aa  AZOR_THICR RecName: Full=FMN-dependent NADH-azoreductase;       
   85::139     8e-05  35%  197 aa  AZOR_SHESH RecName: Full=FMN-dependent NADH-azoreductase;       
    1::139     8e-05  30%  196 aa  AZOR_SHEAM RecName: Full=FMN-dependent NADH-azoreductase;       
   71::197     8e-05  30%  206 aa  AZOR_RHIME RecName: Full=FMN-dependent NADH-azoreductase;       
   85::140     8e-05  41%  201 aa  AZOR_GLUDA RecName: Full=FMN-dependent NADH-azoreductase;       
   15::139     8e-05  30%  211 aa  AZOR_EXISA RecName: Full=FMN-dependent NADH-azoreductase;       
   89::207     8e-05  26%  208 aa  AZOR2_BACHD RecName: Full=FMN-dependent NADH-azoreductase 2;       
    1::139     1e-04  32%  197 aa  AZOR_SHEFN RecName: Full=FMN-dependent NADH-azoreductase;       
    1::142     1e-04  32%  211 aa  AZOR_BACA2 RecName: Full=FMN-dependent NADH-azoreductase;       
   88::142     1e-04  36%  199 aa  AZOR2_PSEPF RecName: Full=FMN-dependent NADH-azoreductase 2;       
   76::141     1e-04  35%  202 aa  AZOR2_PSEAE RecName: Full=FMN-dependent NADH-azoreductase 2;       
   61::173     1e-04  27%  202 aa  AZOR1_PSESM RecName: Full=FMN-dependent NADH-azoreductase 1;       
    6::88      1e-04  31%  183 aa  KEFG_ENT38 RecName: Full=Glutathione-regulated potassium-efflux
   82::152     1e-04  32%  197 aa  AZOR_ERYLH RecName: Full=FMN-dependent NADH-azoreductase;       
   63::136     1e-04  39%  199 aa  AZOR_AZOSE RecName: Full=FMN-dependent NADH-azoreductase;       
   14::132     1e-04  31%  201 aa  AZOR_ANATD RecName: Full=FMN-dependent NADH-azoreductase;       
   11::145     1e-04  29%  195 aa  AZOR_AERS4 RecName: Full=FMN-dependent NADH-azoreductase;       
   84::142     1e-04  31%  213 aa  AZOR3_PSEAE RecName: Full=FMN-dependent NADH-azoreductase 3;       
   64::139     1e-04  28%  199 aa  AZOR1_MESFL RecName: Full=FMN-dependent NADH-azoreductase 1;       
    6::88      2e-04  34%  183 aa  KEFG_SALG2 RecName: Full=Glutathione-regulated potassium-efflux
   85::139     2e-04  33%  197 aa  AZOR_SHELP RecName: Full=FMN-dependent NADH-azoreductase;       
   86::140     2e-04  33%  198 aa  AZOR_SHEB5 RecName: Full=FMN-dependent NADH-azoreductase;       
   88::165     2e-04  37%  216 aa  AZOR2_XANAC RecName: Full=FMN-dependent NADH-azoreductase 2;       
   88::142     2e-04  36%  199 aa  AZOR2_PSEF5 RecName: Full=FMN-dependent NADH-azoreductase 2;       
    1::122     2e-04  30%  186 aa  AZOR1_IDILO RecName: Full=FMN-dependent NADH-azoreductase 1;       
   87::174     2e-04  26%  204 aa  AZOR1_HAHCH RecName: Full=FMN-dependent NADH-azoreductase 1;       
   45::88      2e-04  34%  176 aa  KEFF_ESCF3 RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECOUT RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECOSM RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECOSE RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECOLU RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECOLI RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECOL6 RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECOL5 RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECOK1 RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECOHS RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECODH RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECOBW RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECO8A RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECO81 RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECO7I RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECO5E RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECO57 RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECO55 RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECO45 RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECO27 RecName: Full=Glutathione-regulated potassium-efflux
   45::88      2e-04  34%  176 aa  KEFF_ECO24 RecName: Full=Glutathione-regulated potassium-efflux
   65::137     2e-04  33%  194 aa  AZOR_VIBPA RecName: Full=FMN-dependent NADH-azoreductase;       
   86::140     2e-04  36%  198 aa  AZOR_SHESW RecName: Full=FMN-dependent NADH-azoreductase;       
   86::140     2e-04  36%  198 aa  AZOR_SHEPC RecName: Full=FMN-dependent NADH-azoreductase;       
    1::137     2e-04  27%  197 aa  AZOR_MYCGE RecName: Full=FMN-dependent NADH-azoreductase;       
    1::148     2e-04  35%  211 aa  AZOR_MACCJ RecName: Full=FMN-dependent NADH-azoreductase;       
   87::141     2e-04  35%  202 aa  AZOR_CHRVO RecName: Full=FMN-dependent NADH-azoreductase;       
    4::132     2e-04  33%  201 aa  AZOR_CALS8 RecName: Full=FMN-dependent NADH-azoreductase;       
   35::89      3e-04  38%  174 aa  YRKL_BACSU RecName: Full=Uncharacterized NAD(P)H oxidoreductase
   77::131     3e-04  38%  195 aa  AZOR_STRMK RecName: Full=FMN-dependent NADH-azoreductase;       
   87::173     3e-04  28%  202 aa  AZOR_PSEU2 RecName: Full=FMN-dependent NADH-azoreductase;       
   66::143     3e-04  31%  204 aa  AZOR_METRJ RecName: Full=FMN-dependent NADH-azoreductase;       
   67::145     3e-04  30%  209 aa  AZOR_LEPCP RecName: Full=FMN-dependent NADH-azoreductase;       
   78::136     3e-04  33%  194 aa  AZOR_HAEIE RecName: Full=FMN-dependent NADH-azoreductase;       
   87::141     3e-04  35%  216 aa  AZOR_DIAST RecName: Full=FMN-dependent NADH-azoreductase;       
   87::141     3e-04  35%  216 aa  AZOR_ACISJ RecName: Full=FMN-dependent NADH-azoreductase;       
   87::192     3e-04  25%  203 aa  AZOR5_PSEF5 RecName: Full=FMN-dependent NADH-azoreductase 5;       
   88::165     3e-04  37%  216 aa  AZOR2_XANC5 RecName: Full=FMN-dependent NADH-azoreductase 2;       
   87::143     3e-04  28%  202 aa  AZOR2_HAHCH RecName: Full=FMN-dependent NADH-azoreductase 2;       
   81::139     3e-04  29%  197 aa  AZOR1_PHOPR RecName: Full=FMN-dependent NADH-azoreductase 1;       
   78::136     3e-04  29%  191 aa  AZOR1_JANSC RecName: Full=FMN-dependent NADH-azoreductase 1;       
    7::93      4e-04  32%  184 aa  KEFG_SHIDS RecName: Full=Glutathione-regulated potassium-efflux
   15::205     4e-04  24%  208 aa  AZOR1_BACSU RecName: Full=FMN-dependent NADH-azoreductase 1;       
   71::197     5e-04  27%  206 aa  AZOR_SINMW RecName: Full=FMN-dependent NADH-azoreductase;       
   20::145     5e-04  32%  204 aa  AZOR_SILPO RecName: Full=FMN-dependent NADH-azoreductase;       
   85::139     5e-04  33%  206 aa  AZOR_PSYIN RecName: Full=FMN-dependent NADH-azoreductase;       
    6::92      7e-04  32%  183 aa  KEFG_SHIFL RecName: Full=Glutathione-regulated potassium-efflux
    6::92      7e-04  32%  183 aa  KEFG_SHIF8 RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ESCF3 RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECOUT RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECOSE RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECOLU RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECOLI RecName: Full=Glutathione-regulated potassium-efflux
    6::92      7e-04  32%  183 aa  KEFG_ECOLC RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECOL6 RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECOK1 RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECOHS RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECODH RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECOBW RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECO8A RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECO81 RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECO7I RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECO5E RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECO57 RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECO55 RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECO45 RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECO27 RecName: Full=Glutathione-regulated potassium-efflux
    7::93      7e-04  32%  184 aa  KEFG_ECO24 RecName: Full=Glutathione-regulated potassium-efflux
   89::132     7e-04  40%  217 aa  AZOR_POLNA RecName: Full=FMN-dependent NADH-azoreductase;       
   82::142     7e-04  39%  204 aa  AZOR_HERAR RecName: Full=FMN-dependent NADH-azoreductase;       
   83::141     7e-04  32%  206 aa  AZOR_ACIC5 RecName: Full=FMN-dependent NADH-azoreductase;       
    1::142     7e-04  31%  211 aa  AZOR3_BACCZ RecName: Full=FMN-dependent NADH-azoreductase 3;       
   91::150     7e-04  27%  240 aa  AZOR2_IDILO RecName: Full=FMN-dependent NADH-azoreductase 2;       
    7::93      0.001  36%  184 aa  KEFG_ENTS8 RecName: Full=Glutathione-regulated potassium-efflux
   88::140     0.001  30%  208 aa  AZOR_HYPNA RecName: Full=FMN-dependent NADH-azoreductase;       
   78::136     0.001  32%  194 aa  AZOR_HAEIG RecName: Full=FMN-dependent NADH-azoreductase;       
   34::140     0.001  32%  212 aa  AZOR_DELAS RecName: Full=FMN-dependent NADH-azoreductase;       
   87::142     0.001  30%  208 aa  AZOR_BORPD RecName: Full=FMN-dependent NADH-azoreductase;       
    1::149     0.001  23%  199 aa  AZOR4_BURS3 RecName: Full=FMN-dependent NADH-azoreductase 4;       
   87::141     0.001  33%  203 aa  AZOR3_PSEPF RecName: Full=FMN-dependent NADH-azoreductase 3;       
   85::110     0.001  42%  202 aa  AZOR2_BRAJA RecName: Full=FMN-dependent NADH-azoreductase 2;       
   75::101     0.001  41%  194 aa  AZOR1_XANC5 RecName: Full=FMN-dependent NADH-azoreductase 1;       
   75::101     0.001  41%  193 aa  AZOR1_XANAC RecName: Full=FMN-dependent NADH-azoreductase 1;       
   37::145     0.001  28%  208 aa  AZOR1_BRAJA RecName: Full=FMN-dependent NADH-azoreductase 1;       
    1::189

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFAGEQAGEDVLDHRRRIEKCDI
NQO2_RAT        -KKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPVFKGIEAYEDILEEQRKVQEADL
Y1544_HAEIN     -----IIFAHPNSRSFGRAIANRIEQISQENGVNVFFRDLYEMNFNPILSHEELQEDIQQEHDFILQADL
NQO2_PONAB      -KKVLIVYAHQEPRSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPAYKQRSLASDITDEQKKVQEADL
NQO2_HUMAN      -KKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPAYKQRSLASDITDEQKKVREADL
NQO1_CAVPO      ---------HSEKTSFNYAMKEAAVEALQRKGWEVAVSDLYAMKFDPIISRKRLSPDIVTEQKKVEEADL
NQO1_PONAB      -RRALIVLAHSERTSFNYAMKEAAVAALKKKGWEVVESDLYAMNFNPIISRKDISPDIVAEQKKLEAADL
NQO1_RAT        VRRALIVLAHAERTSFNYAMKEAAVEALKKKGWEVVESDLYAMNFNPLISGERLSPDIVAEQKKLEAADL
NQO1_MOUSE      -RRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISGERLSPDIVAEHKKLEAADL
NQO2_MOUSE      -KKVLIVYAHQEPKSFNGSLKKVAVEELSKQGCTVTVSDLYSMNFEPAYKKKALTSDIFEEQRKVQEADL
NQO1_HUMAN      -RRALIVLAHSERTSFNYXXXXXXXXXXXXXGWEVVESDLYAMNFNPIISRKDISPDIVAEQKKLEAADL
YCAK_ECOLI      -ERIYLVWAHPRHDSLTAHIADAIHQRAMERKIQVTELDLYRRNFNPVMTPEDEPDEVHQLYSELLEHDT
AZOR_BEII9      --------------------------------------------------------------------DL
AZOR_MYCGA      -----------NEASFSYQLAKTFESEYLKPSDQVSWLDLNEDKGSMTLTSKNSKEHFKDENNQIKSVDK
AZOR_CLOB8      -------------KSRTFKISDVFIDEYKQNNDEIITLDLYKEDIDTVFGPESKNHPTLKYAYQFAEADK
AZOR_SHEON      MSKVLVLLGGYSQ---SALLVDYLIGKWEKQGATITVRDLAGKDVLPMVDGEIASQEMLDLSNELKANDT
AZOR_CLOPS      -------------------VSDSFVEEYKKNNDQIITLDLYKENIDFLRADESKNNSILKYAYQFADADK
AZOR_CLOP1      -------------------VSDSFVEEYKKNNDEIITLDLYKENIDFLRADESKNNSILKYAYQFADADK
AZOR3_BACHD     MAKVLYITAHNEEQSFSLAAGTAFIETEEHKDDEVIHLDLYKEEIPHIDAHVFSGWGKLQNNKGFEEADK
AZOR1_COLP3     ------------------------------------------------------------------KAEH
AZOR_SHESR      MSKVLVLLGGYSQ---SALLVDHLIGKWEDQGATITVRDLAGKDVLPMVDGEIAGGDDLTARQQLKANDT
AZOR_SHESM      MSKVLVLLGGYSQ---SALLVDHLIGKWEDQGATITVRDLAGKDVLPMVDGEIAGGDDLTARQQLKANDT
AZOR2_CLOPE     -------------------VSDSFVEEYKKNNDEIITLDLYKDDLGKLFGTESKNNSILKYAYQFADADK
AZOR_BRASB      --------------------------------------------------------------------DV
AZOR_MYCS5      MAKVLVLSGGLSEKSYSSQMLDLFVKTYKEPNDELEFVDLNTTKHAEVFLSRNTWKDVESDKDKLKAADK
AZOR_SHESA      MSKVLVLLGGYSQ---SALLVDHLIGKWEDQGATITVRDLAGKDVLPMVDGEIASQEMLDLSNELKANDT
AZOR_RALSO      ------------------------------------------DGFDAVTLAEHARSEALVGE--LLASDV
AZOR_FRAP2      -----------------------------------DLVDNSVEHINPDFINAMANNNLATSNKLIEELDI
AZOR_BACP2      MAKVLYITAHPHDESYSMATAKAFIESYKEANPSDEVVDLYKENIPDVFAGSGAGFDTLSAEEQAKSADK
AZOR2_COLP3     ----------------------------------------------------------------VDQADI
AZOR_VIBVU      ----------------------------------------------------------------IKEADT
AZOR_MYCMO      --------------SFSSALSDKFMEYYRKENDQKDLISLSSQNFNTFFT-DGVSDKYIDQLKSVDK---
AZOR1_BACLD     ------------EEAVSVKLYEAFLNSYKENHPNDEIVELDLYRENPPYLGEKAAAAVADYLDEFVKADK
AZOR_PELUB      ----------------------------------------------------------------LKESDI
AZOR_COPPD      -----------NEESRTFRISEHFIKKAHPEDEIIE-LDLYKEEINTIMSKDKSNHPVLKYTYQFAEADK
AZOR_VIBVY      ----------------------------------------------------------------IKAADT
AZOR_RHOFD      --------------------------------------------------------------------DV
AZOR_GEOKA      MTKVLYITAHPHDQSYSMAVGKAFIETYKQPDHEVIHLDLYKEYIPEVFSGELSDEEKAKVGRMNELCDK
AZOR_RHISN      ------------------------------------------DGVDPALASDRTGRQMLDE---FLAADT
AZOR_AZOVD      --------------------------------------------------------------------DV
AZOR_PSEA6      ---------------------------------------------------------------QLERSDV
AZOR2_PSEPK     --------------------------------------------------------------------DV
KEFF_SHISS      --------------------------------------------------------DIAAEQEALSRADL
AZOR_SHEDO      ------ILGDYSQSS---ALIGHLMSHWQQQGAQMTVRDLAADPV-PVLDGEIAGGDNLSPRQQLKSHDT
AZOR_RHOSK      ----------------------------------------------------------------VKEADI
AZOR_RHOS4      ----------------------------------------------------------------VKEADI
AZOR_RHOS1      ----------------------------------------------------------------VKEADI
AZOR_BACST      ---------HDDTQSYSMAVGKAFIDTYKQPDHEVIHLDLYKEYIPEVFSGELSDEEKAKVGRMNELCDK
AZOR2_CLOAB     -------------------ISDSFIEEYQKPNDEIITLDLYKEKLHVPKQGEGKDHHVLKYAYQFAEADK
KEFF_ENT38      --------------------------------------------------------DIAAEQEAISRADL
AZOR_SHEB9      --------------------------------------------------------------------DT
AZOR_SHEB8      --------------------------------------------------------------------DT
AZOR_SHEB2      --------------------------------------------------------------------DT
AZOR2_BACSU     MAKVLYITAHPHDESYSMATGKAFIKEANPNDEVVH-IDLYKENIPHIDADVFSGWGKLQSGTGFEEADK
KEFG_SALTY      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
KEFG_SALTI      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
KEFG_SALSV      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
KEFG_SALPK      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
KEFG_SALPC      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
KEFG_SALPB      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
KEFG_SALPA      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
KEFG_SALNS      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
KEFG_SALHS      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
KEFG_SALEP      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
KEFG_SALDC      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
KEFG_SALCH      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
KEFG_SALA4      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
KEFG_CITK8      --KVLLLYAH--PESQDSVANRVLLKPAMQLSN-VTVHDLYAHY--PDFFIDIAHEQAL-----LREHDV
KEFF_SHIFL      --------------------------------------------------------DIAAEQEALSRADL
KEFF_SHIF8      --------------------------------------------------------DIAAEQEALSRADL
KEFF_SHIDS      --------------------------------------------------------DIAAEQEALSRADL
KEFF_SHIBS      --------------------------------------------------------DIAAEQEALSRADL
KEFF_SHIB3      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECOLC      --------------------------------------------------------DIAAEQEALSRADL
AZOR_THIDA      --------------------------------------------------------------------DV
AZOR_THICR      -----------------------------------------------------------DYIEQLKKADV
AZOR_SHESH      --------------------------------------------------------------------DT
AZOR_SHEAM      MSKVLVLKSSIGDFSQSGRLIDEWVAARRASGDTVTVRDLAAEPL-PVLDGEIAGGESLSPRQQLKVHDQ
AZOR_RHIME      --------------------------------------------------------DVRIGRQMLEEADT
AZOR_GLUDA      --------------------------------------------------------------------DI
AZOR_EXISA      ------------ELSYSKQVAETFVSTAENASIEVEAIELYDVDVQEIFASGEALTDVEAKKEKFMEADL
AZOR2_BACHD     ------------------------------------------------------------------EADK
AZOR_SHEFN      MAKVLILLGSYSQSS---ALVDYLNQQWSSKGAQIKVRDLGENTL-PMLDGELAGGDNLSERQEIKAHDT
AZOR_BACA2      MAKVLYITAHHDEKSYSMATGKAFIDSKESNPNDVVHIDLYKENIPHIDADVFSGEELSENEKQFAAADK
AZOR2_PSEPF     --------------------------------------------------------------------DV
AZOR2_PSEAE     ------------------------------------------------------GEEVLEE---FLAADV
AZOR1_PSESM     ----------------------------------------------PVEARDAAQQQEVDNNQQFLDADV
KEFG_ENT38      --KVLLLYAH--PESQDSVANRVLLKPAQQLSNVTDLYAHYPDFFI----------DIPREQELLRQHDV
AZOR_ERYLH      ----------------------------------------------------------------LQAADT
AZOR_AZOSE      ------------------------------------------DKRTPEQTARVALDDVLI--AEIQAADA
AZOR_ANATD      -----------NQSSRTFIISEHFIKVYKEPNDQIITLDLYKEDINDIFAPKTEASKILKYAYQFAEADK
AZOR_AERS4      ------ILGQYSQSN---ALIDGFL--ADHQSDTVTVRDLATLNL-PVLDGELAGGDNLNERQELKGSDL
AZOR3_PSEAE     ----------------------------------------------------------------LRMADV
AZOR1_MESFL     --------------------------------------------------GEEEGMKYINQLKDVDK---
KEFG_SALG2      --KVLLLYAH--PESQDSVANRVLLKPAIQHNN-VTVHDLYARY--PDFFIDTPYEQAL-----LREHDV
AZOR_SHELP      --------------------------------------------------------------------DT
AZOR_SHEB5      --------------------------------------------------------------------DT
AZOR2_XANAC     --------------------------------------------------------------------DI
AZOR2_PSEF5     --------------------------------------------------------------------DV
AZOR1_IDILO     MKVLHLDSGIFLEQSVSRQVSQNIVKLKEKQDITLFHRDLVANPVPHLAADELLAEELIDELQELLDADT
AZOR1_HAHCH     ----------------------------------------------------------------VQAADT
KEFF_ESCF3      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECOUT      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECOSM      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECOSE      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECOLU      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECOLI      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECOL6      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECOL5      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECOK1      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECOHS      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECODH      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECOBW      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECO8A      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECO81      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECO7I      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECO5E      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECO57      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECO55      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECO45      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECO27      --------------------------------------------------------DIAAEQEALSRADL
KEFF_ECO24      --------------------------------------------------------DIAAEQEALSRADL
AZOR_VIBPA      ---------------------------------------------------QQAVVDLSDTLEEVKAADT
AZOR_SHESW      --------------------------------------------------------------------DT
AZOR_SHEPC      --------------------------------------------------------------------DT
AZOR_MYCGE      MKKVIIVDASVTPSSYTHLLLDRFLQTYKKQNSSVEFIDVGKISYNTQNASNFFSFENSDYYIDALKTAY
AZOR_MACCJ      MTKVLYITGHPNDESNSMAAGKSFIESYKQSNHEVVHIDLY-DTFIPVFDGEALSETEQQKVARLNEADK
AZOR_CHRVO      --------------------------------------------------------------------DV
AZOR_CALS8      -----LLYIKANPKSDQSSISEHFIKVYKEPNDQIITLDLYKEDINDIFAPKTEASKILKYAYQFLEADK
YRKL_BACSU      --------------------------------------DLYGEYPNFIIDVEKEQQLLLDHER-------
AZOR_STRMK      --------------------------------------------------------------------DI
AZOR_PSEU2      --------------------------------------------------------------------DV
AZOR_METRJ      ----------------------------------------------PLDAAGQAVRDASDRMSEFVAADT
AZOR_LEPCP      ------------------------------------------DQRTPAQAERVALDDALI--AEIQAADV
AZOR_HAEIE      ----------------------------------------------------------------LKNAQT
AZOR_DIAST      --------------------------------------------------------------------DV
AZOR_ACISJ      --------------------------------------------------------------------DV
AZOR5_PSEF5     --------------------------------------------------------------------DT
AZOR2_XANC5     --------------------------------------------------------------------DI
AZOR2_HAHCH     --------------------------------------------------------------------EL
AZOR1_PHOPR     ----------------------------------------------------------------LQNSDT
AZOR1_JANSC     ----------------------------------------------------------------VQAADT
KEFG_SHIDS      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTAHDLYAHY--PDFFIDIPREQAL-----LREHEV
AZOR1_BACSU     ------------EEGVSTKLYEAFLAAYKENNPNDEVVDLHKDMINGTFKAGQGMEMTEDEKKQAAKADK
AZOR_SINMW      --------------------------------------------------------DVRIGRQMLEEAET
AZOR_SILPO      ------------------ALADAFVAAQRAKDSTVDHLDLWAEDL-PAFDGEQAWSAVARITERFMSADH
AZOR_PSYIN      --------------------------------------------------------------------DL
KEFG_SHIFL      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_SHIF8      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ESCF3      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECOUT      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECOSE      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECOLU      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECOLI      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECOLC      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECOL6      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECOK1      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECOHS      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECODH      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECOBW      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECO8A      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECO81      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECO7I      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECO5E      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECO57      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECO55      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECO45      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECO27      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
KEFG_ECO24      --KVLLLYAH--PESQDSVANRVLLKPATQLSN-VTVHDLYAHY--PDFFIDIPREQAL-----LREHEV
AZOR_POLNA      --------------------------------------------------------------------DV
AZOR_HERAR      --------------------------------------------------------------RELFDADV
AZOR_ACIC5      ----------------------------------------------------------------LERADE
AZOR3_BACCZ     MTKVLFITANPNEGSFGMAVGEAFIE-AYKNEHPQDTIDLFNTTVPAIFAAGEGFETLTEAQQQFMNADR
AZOR2_IDILO     ----------------------------------------------------------------VSAADV
KEFG_ENTS8      --KVLLLYAH--PESQDSVANRVLLKPALQLPN-VTVHDLYAHY--PDFFIDISHEQALDH-------DV
AZOR_HYPNA      ----------------------------------------------------------------------
AZOR_HAEIG      ----------------------------------------------------------------LKNAQT
AZOR_DELAS      -------------------------------GAKVEYLDLAPDHLNAVSMGFRTGQAATTEAERAQNADV
AZOR_BORPD      --------------------------------------------------------------------DR
AZOR4_BURS3     MARILVLKSSINSQSQTSTLIDTFLAERQANGHADDVIELFHALRGAANPSERAQRAIVELIAELKGSDL
AZOR3_PSEPF     --------------------------------------------------------------------DA
AZOR2_BRAJA     --------------------------------------------------------------------DV
AZOR1_XANC5     ------------------------------------------------------------------QADV
AZOR1_XANAC     ------------------------------------------------------------------QADV
AZOR1_BRAJA     ----------------------------------IDVMDLWRERM-PEFAGRMKAEAFDDAQRRLSLAER


                         .         .         *         .         .         .         .:140
query           IVLIAPIWNFRMPAIVEGWIDKVLSPPWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSPRLAVTTFFLN
NQO2_RAT        VIFQFPLYWFSVPAILKGWMDRVLCQGFAFDVPGF-----YDSGFLKDKLALLSFTTGGTAEMYTKAGVN
Y1544_HAEIN     ITLVYPLWWMGFPAILKGYLDRVLSHGFAYKTEN-----GESVGLLKNKQMQQFITIGSNVDKYKEFGVD
NQO2_PONAB      VIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGF-----YDSGLLQGKLALLSVTTGGTAEMYTKTGVN
NQO2_HUMAN      VIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGF-----YDSGLLQGKLALLSVTTGGTAEMYTKTGVN
NQO1_CAVPO      LIFQFPLQWFGVPAILKGWFERVFTGGFAYTYAAM-----YDKGPFQNKKAVLSITTGGSELKGIHGDMN
NQO1_PONAB      VIFQFPLQWFGVPAILKGWFERVFVGEFAYTYAAM-----YDKGPFRSKKAVLSITTGGSSLQGIHGDMN
NQO1_RAT        VIFQFPLYWFGVPAILKGWFERVLVAGFAYTYATM-----YDKGPFQNKKTLLSITTGGSSLQGVHGDMN
NQO1_MOUSE      VIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAM-----YDNGPFQNKKTLLSITTGGSSLQGVHGDMN
NQO2_MOUSE      VIFQFPLYWFSVPAILKGWMDRVLCRGFAF----------------------------------------
NQO1_HUMAN      VIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAM-----YDKGPFRSKKAVLSITTGGSSLQGIHGDMN
YCAK_ECOLI      LVVVFPLWWYSFPAMLKGYIDRVWNNGLAY----------------------------------------
AZOR_BEII9      LVIATPMWNFGIPSVLKAWIDLVVRPGRTFQYAD-----GEVLGLAKDKKAILVLASG------------
AZOR_MYCGA      LVVIAPMTNFNYPATLKNWLDKICVANKTFSYK--YSKKGGSIGLMDHLKVMIINTQGAPE----GWYAF
AZOR_CLOB8      YVIAAPMWNLSIPAILKAYVDSVVGIAFKYTQEGAV-------GLLENKKAVYIAARGG-SYAETPYELD
AZOR_SHEON      IVITAPMYNFNIPTQLKNWIDFVARAGVTFTYTE-----NGPKGLVEGKRAVLITTRG------------
AZOR_CLOPS      YIIAAPMWNLSFPAILKAYIDYVSVS--GITFKYTAEG---PVGLLNNKKAVHIVSRG------------
AZOR_CLOP1      YIIAAPMWNLSFPAILKAYIDYVSVS--GITFKYTAEG---PVGLLNNKKAVHIVSRG------------
AZOR3_BACHD     YVFVTPLWNFSFPPVLKAYIDAV-----AVAGKTFKYTEQGPVGLLTDKKAL------------------
AZOR1_COLP3     IVIGLPIYNFGVPAAFKAWIDQVVR-------SKLTFRYGGPVGLVENKKAYIIIASGGTKLGTEIDFIS
AZOR_SHESR      IVITAPMYNFNIPTQLKNWIDFVARAGVTFTYTE-----NGPKGLVEGKRAVLITTRG------------
AZOR_SHESM      IVITAPMYNFNIPTQLKNWIDFVARAGVTFTYTE-----NGPKGLVEGKRAVLITTRG------------
AZOR2_CLOPE     YIIAAPMWNISFPAILKAYIDYVSVS--GITFKYTAEG---PVGLLNNKKAVHIVSRG------------
AZOR_BRASB      IVIGAPMYNFGVPSQLKAWIDRLAVPGKTFSY----GEHG-PVGLCKGKKVIVASARG------------
AZOR_MYCS5      VILSCSMTNFGPTAVVKNFIDSVAVANKTFSYK--YSKKGDAVGLLDHLRVMIVTTQGAPK---------
AZOR_SHESA      IVITAPMYNFNIPTQLKNWIDFVARAGVTFTYTE-----NGPKGLVEGKRAVLITTRG------------
AZOR_RALSO      IVVGAPMYNFSVPSQLKAWIDRVAQAGRTFKYTET-----GPVGLTGGKKVIVASTRGGMYSAGPTAAMD
AZOR_FRAP2      IAIESPMYNFSIPSTLKSWIDNIM-----IARKTFLYTANGPEGLVKNKKAILVLSKGN-----------
AZOR_BACP2      YVFVSPLWNFSFPPVLKAYIDSV-----AVAGKTFKYTEQGPVGLLTDKKAL------------------
AZOR2_COLP3     IVISSPMYNYGMPAVLKAWFDQVVRINKTFTFDLARGDF-------------------------------
AZOR_VIBVU      LVIAAPMYNFTIPTQLKNWIDLIARAGVTFTYTE-----QGPKGLIEGKKAVIVTTRG------------
AZOR_MYCMO      VVISSPMTNFNYTALLKNYLDRILVANKTFSYK--YSKKGEAIGLLPHLKVQILTTQGAP----------
AZOR1_BACLD     VVFAFPLWNFAVPAVLHTYVDYLSRAGVTFTYTP-----EGPKGLMGDKKVALLNARGGSEGPMAAMEMS
AZOR_PELUB      IIISAPIYNYGPPATLKAWCDLAARIGETFKFKP----NGRREGLLKNKQAYLVITSGGTKLNSSEDFL-
AZOR_COPPD      YVIATPMWNLSIPAILKAYFDYITVT--GITFKYTENG---AVGLLKNKKAVVIMSTGGEYL--------
AZOR_VIBVY      LVIAAPMYNFTIPTQLKNWIDLIARAGVTFTYTE-----QGPKGLIEGKKAVIVTTRG------------
AZOR_RHOFD      IVIGAPFYNFSIPTQLKAWIDRLAQPGRTFTY-----NEKGPLGLATGKTVIVASTRG------------
AZOR_GEOKA      YVFVTPMWNFSFPPVLKAYIDAV-----AVAGKTFKYTEQGPVGLLTDKKALHIQARGG-------FYSE
AZOR_RHISN      IVVGAPMYNFSIPSQLKAWIDRL-----AVAGKTFRYTEAGPEGLAKGKKVIVASTRGGHYSAGPAAAMD
AZOR_AZOVD      LVLAAPMYNFAIPSTLKAWLDHVLRA--GVTFKYTENG---PQGLLSGKRAFVLTARG------------
AZOR_PSEA6      IVVGMPMYNFTIPSTFKAWIDRVARAGRTFSYTS-----EGPKGHLQGKTVYIFAARG------------
AZOR2_PSEPK     LVMAAPMYNFTIPSTLKAWLDHVLRA--GITFKYTPTG---PQGLLTGKRAIVLTARG------------
KEFF_SHISS      IVWQHPMQWYSIPPLLKLWIDKVLSHGWAYGHKALHGKY-------------------------------
AZOR_SHEDO      LVIAAPMYNFSIPTQLKNWIDLIARAGVTFTYTET-----GPKGLLEGKRAVVVTTRG------------
AZOR_RHOSK      LVIALPVYNFGAPAQLKSWVDHIARRGESFVYTET-----GPVGLLTGKRAIVFTSDGTP----------
AZOR_RHOS4      LVIALPVYNFGAPAQLKSWVDHIARRGESFVYTET-----GPVGLLTGKRAIVFTSDGTP----------
AZOR_RHOS1      LVIALPVYNFGAPAQLKSWVDHIARRGESFVYTET-----GPVGLLTGKRAIVFTSDGTP----------
AZOR_BACST      YVFVTPMWNFSFPPVLKAYIDAV-----AVAGKTFKYTEQGPVGLLTDKKALHIQARGG-------FYSE
AZOR2_CLOAB     YVIAAPFWNLSFPAILKAYIDYI-----------------------------------------------
KEFF_ENT38      IVWQHPMQWYSTPALLKLWIDKVFSHGWAY----------------------------------------
AZOR_SHEB9      IVIAAPMYNFTIPAQLKNWIDFIARAGVTFTYTET-----GPKGLVEGKRAVLVTTRG------------
AZOR_SHEB8      IVIAAPMYNFTIPAQLKNWIDFIARAGVTFTYTET-----GPKGLVEGKRAVLVTTRG------------
AZOR_SHEB2      IVIAAPMYNFTIPAQLKNWIDFIARAGVTFTYTET-----GPKGLVEGKRAVLVTTRG------------
AZOR2_BACSU     YVFVTPLWNFSFPPVMKAYLDSV-----AVAGKSFKYTEQGPVGLLTDKKAI------------------
KEFG_SALTY      IVFQHPLYTYSCPALLKEWLDRVLSRGFASGGNQLVGKY-------------------------------
KEFG_SALTI      IVFQHPLYTYSCPALLKEWLDRVLSRGFASGGNQLVGKY-------------------------------
KEFG_SALSV      IVFQHPLYTYSCPALLKEWLDRVLSRGFASGGNQLVGKY-------------------------------
KEFG_SALPK      IVFQHPLYTYSCPALLKEWLDRVLSRGFASGGNQLVGKY-------------------------------
KEFG_SALPC      IVFQHPLYTYSCPALLKEWLDRVLSRGFASGGNQLVGKY-------------------------------
KEFG_SALPB      IVFQHPLYTYSCPALLKEWLDRVLSRGFASGGNQLVGKY-------------------------------
KEFG_SALPA      IVFQHPLYTYSCPALLKEWLDRVLSRGFASGGNQLVGKY-------------------------------
KEFG_SALNS      IVFQHPLYTYSCPALLKEWLDRVLSRGFASGGNQLVGKY-------------------------------
KEFG_SALHS      IVFQHPLYTYSCPALLKEWLDRVLSRGFASGGNQLVGKY-------------------------------
KEFG_SALEP      IVFQHPLYTYSCPALLKEWLDRVLSRGFASGGNQLVGKY-------------------------------
KEFG_SALDC      IVFQHPLYTYSCPALLKEWLDRVLSRGFASGGNQLVGKY-------------------------------
KEFG_SALCH      IVFQHPLYTYSCPALLKEWLDRVLSRGFASGGNQLVGKY-------------------------------
KEFG_SALA4      IVFQHPLYTYSCPALLKEWLDRVLSRGFASGGNQLVGKY-------------------------------
KEFG_CITK8      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFF_SHIFL      IVWQHPMQWYSIPPLLKLWIDKVLSHGWAY----------------------------------------
KEFF_SHIF8      IVWQHPMQWYSIPPLLKLWIDKVLSHGWAY----------------------------------------
KEFF_SHIDS      IVWQHPMQWYSIPPLLKLWIDKVLSHGWAY----------------------------------------
KEFF_SHIBS      IVWQHPMQWYSIPPLLKLWIDKVLSHGWAY----------------------------------------
KEFF_SHIB3      IVWQHPMQWYSIPPLLKLWIDKVLSHGWAY----------------------------------------
KEFF_ECOLC      IVWQHPMQWYSIPPLLKLWIDKVLSHGWAY----------------------------------------
AZOR_THIDA      LVIATPIYNFGVPASLKAWVDQVARA--RLTFRDT--EYG-PEGLLTGKKAYVLVASG------------
AZOR_THICR      ILISTPMYNFGIPSTLKAYLDHSLGETFVYTDKG-------PKGLLEGKKAIVVAASG------------
AZOR_SHESH      IVIAAPMYNFSIPTQLKNWIDLVARAGVSFTYTET-----GPKGLITGKRAVLITTRG------------
AZOR_SHEAM      LVVAAPMYNFSIPTQLKNWIDLVARAGVTFTY-----TAEGPQGLIQGKQAMLITTRG------------
AZOR_RHIME      VVVGAPMYNFSIPSQLKAWIDRL-----AVAGKTFRYTEAGPEGLAKGKKLIVASTRGGHYSVAPASAMD
AZOR_GLUDA      VVIGAPMYNFTIPTQLKSWLDRVLVP--GRTFK--YGPEGV-KGLVEGKRVIVALSRGS-----------
AZOR_EXISA      YVFATPMWNFFFPARMKMFLDSVLMAGKTFRYTE-----QGPVGLLENKQAI------------------
AZOR2_BACHD     VVFAFPLWNFTIPAALHTYMDYLARAGVTFNY-----TAEGPVGLMGDKKVALLNARGGYYSEGPAAQLE
AZOR_SHEFN      IIIAAPMYNFGIPTTLKNWIDLIARAGVTFTYTDTGA-----VGLIEGKRAIIVTTRG------------
AZOR_BACA2      YVFVTPLWNFSFPPVMKAYLDSV-----AVAGKSFKYTEQGPIGLLTDKKAL------------------
AZOR2_PSEPF     LVMAAPMYNFAIPSTLKAWLDHVLRA--GVTFKYTETG---PQGLLSGKRAYVLTARG------------
AZOR2_PSEAE     VVIGAPMYNFTISSQLKAWIDRI-----AVAGKTFRYTENGPVGLAGDKKVVIVSTAG------------
AZOR1_PSESM     LVIGAPMYNFSIPSQLKAWIDRIAVAGRTFRYSE-----AGPEGLCGGKKVIIVSTSGGLHQGLPT---G
KEFG_ENT38      IVFQHPLYTYSCPALLKEWLDRVLS---------------------------------------------
AZOR_ERYLH      IVLGVPIYNFSVPATVKAWADTVARAGTTFEYTPT-----GPKGKLDGKKAYITVASGGTPVGSEVDFMS
AZOR_AZOSE      VVIGVPMYNFGVPVQLKNWID-------AITRVKVTFRYNGPEGLLKDKKVYV-----------------
AZOR_ANATD      YVFAAPMWNLGIPAILKAYIDYITVS--GITFKYTEQG---AVGLLRGKKAV------------------
AZOR_AERS4      VVIAAPMYNFSIPTQLKNWIDLIARAGVTFRYTET-----GPVGLVENTRALVISPRGGMHVGSAT----
AZOR3_PSEAE     LVLAAPMYNFAIPSSLKSWFDHVLRAGLTFRYAE-----QGPEGLLQGKRAFVLTARG------------
AZOR1_MESFL     LLVIAPMYNFHVSGMLKNYIDHVALANQTFSYK--YATKGASIGLLDKLKVQILATQGAPK---------
KEFG_SALG2      IVFQHPLYTYSCPALLKEWLDRVLS---------------------------------------------
AZOR_SHELP      LVIAAPMYNFSIPTQLKNWIDLVARAGVTFTYTET-----GPKGLVEGKRAVLVTTRG------------
AZOR_SHEB5      IVIAAPMYNFTIPTQLKNWIDFIARAGVTFTYTET-----GPKGLVEGKRAVLVTTRG------------
AZOR2_XANAC     VVIGAPMYNFSVPTQLKAWIDRIAQPGRTFRYKQLIGMYAQPMASLDFQEAYLTATFG------------
AZOR2_PSEF5     LVMAAPMYNFAIPSTLKAWLDHVLRA--GVTFKYTDTG---PQGLLTGKRAYVLTARG------------
AZOR1_IDILO     LVIGAPMYNFTIPTQLKAWFDRVLQA--GVTFKYTEQG---PQGLVNGKKVYI-----------------
AZOR1_HAHCH     LVIAVPMYNFSVPATLKAYIDQICRAQVTFRYTE-----QGPVGLLENKKAVVTVTGGTPVNSAADF---
KEFF_ESCF3      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECOUT      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECOSM      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECOSE      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECOLU      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECOLI      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECOL6      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECOL5      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECOK1      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECOHS      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECODH      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECOBW      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECO8A      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECO81      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECO7I      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECO5E      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECO57      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECO55      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECO45      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECO27      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
KEFF_ECO24      IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
AZOR_VIBPA      LVIAAPMYNFTIPTQLKNWIDLIARA--GVTFKYTENGV---QGLIEGKKAIVVTTRG------------
AZOR_SHESW      IVIAAPMYNFTIPAQLKNWIDFIARAGVTFTYTE-TGSKGLVEG----KRAVLVTTRG------------
AZOR_SHEPC      IVIAAPMYNFTIPAQLKNWIDFIARAGVTFTYTE-TGSKGLVEG----KRAVLVTTRG------------
AZOR_MYCGE      IVILAPMTNFNYPASLKNFIDHVFVA--NKTFQDKYVTKGASKGLLTNLKVVVLASQGAP----------
AZOR_MACCJ      YIFVTPMWNLSFPAVVKAYIDAVAGKAFKYTAEGAV-------GLLTDKKALLIQSRG------------
AZOR_CHRVO      LVIGAPMYNFSIPTQLKSWIDRVAAA--GRTFKYTENG---PVGLVPNKKVVLVSARG------------
AZOR_CALS8      YVFAAPMWNLGIPAILKAYIDYITVS--GITFKYTEQG---AVGLLRGKKAV------------------
YRKL_BACSU      IVFQFPMYWYSSPALLKQWEDDVLTHGWAY----------------------------------------
AZOR_STRMK      VVIGAPMYNFSIPSTLKAWIDRVAVA--GRTFKYTENG---PVGLASGKRVIIASSRG------------
AZOR_PSEU2      LVIGAPMYNFTIPTQLKAWFDRILIAGRTFRYSE-----AGPEGLCGGKKVIIVSTSGGLHAGQPT---G
AZOR_METRJ      VVIGVPMYNFTIPSQLKAWIDRLLVPGTTFRY----GAAG-PEGLMGGKRVILALARG------------
AZOR_LEPCP      VVIAAPMFNFGITAQLKNWIDAIARAKVTFQY-----TANGPEGLLKGKRVHVVLTRG------------
AZOR_HAEIE      LIIGAPMYNLNIPTQLKSYFDFIARPTFQYTAKG-------PEGLLKGKKAIVLCAFG------------
AZOR_DIAST      VVIGAPFYNFAIPTQLKAWIDRIAQP--GRTFQYTANG---PEGLAKGKTVIVASSRG------------
AZOR_ACISJ      VVIGAPFYNFAIPTQLKAWIDRIAQP--GRTFQYTANG---PEGLAKGKTVIVASSRG------------
AZOR5_PSEF5     VVVAAPMYNFTIPTQLKAWIDRIAVAGETFRYTE-----AGPQGLCGGKKVIVVSTSGGLHVGQATGVAH
AZOR2_XANC5     VVIGAPMYNFSVPTQLKAWIDRIAQPGRTFRYKQLIGMYTQPMASLDFQEAYLTATFG------------
AZOR2_HAHCH     IVLSSPMWNLGLPSVLKAWFDHITRAGRTFRFT----DGGDKIGLVADRKVYVVMASGS-----------
AZOR1_PHOPR     IVIAAPMYNFSVPTQLKNWFDIIARAGVTFSYTE-----NGPVGLITGKKVIVVTTRG------------
AZOR1_JANSC     LVIGLPIYNFGVPAALKAWVDQIARAGVTFQYTET-----GPKGLLEGKRAIVAVASG------------
KEFG_SHIDS      IVFQRPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
AZOR1_BACSU     VVFAFPLWNFTVPAVLHTYVDYLSRA--GVTFKYTQEG---PVGLMGGKKVALLNARGGVYSEGPMAALE
AZOR_SINMW      VVVGAPMYNFSIPSQLKAWIDRLAVAGKTFRYSEAGAE-----GLAKGKKVIVASTRGGHYSVAPASAMD
AZOR_SILPO      VVMGVPMWNGGIPYRLKHYIDIITQPGMLFGFDP---DNGY-SGLLRNRKATVVTTSG------------
AZOR_PSYIN      LVIAAPMYNFMIPTQLKNWIDLVARAGKTFSYTE-----QGPQGLISGTRAIIVTTRG------------
KEFG_SHIFL      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_SHIF8      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ESCF3      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECOUT      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECOSE      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECOLU      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECOLI      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECOLC      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECOL6      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECOK1      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECOHS      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECODH      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECOBW      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECO8A      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECO81      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECO7I      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECO5E      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECO57      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECO55      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECO45      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECO27      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
KEFG_ECO24      IVFQHPLYTYSCPALLKEWLDRVLSRGFA-----------------------------------------
AZOR_POLNA      LVIGAPLYNFSIPSQLKAWIDRVAQATFKYTEKGPVGLAG------------------------------
AZOR_HERAR      IVIGAPMYNFSITSGLKAWIDHVAGVTFKYTDKG-------PVGLLTGKKVYIFTASG------------
AZOR_ACIC5      YAIGVAMHNFSIPAVLKLWIDQVVRVGRTFAYSD-----GRPQGLLQGKKATILAATG------------
AZOR3_BACCZ     YVFVTPMWNFSYPPVVKAYLDNV-----AIAGKTFKYTENGPVGLLEGKKAL------------------
AZOR2_IDILO     IVISSPMYNYGMPAQLKAWFDQIVRINKTFDFDLSRGD--FPLQPILSGKTLITVT--------------
KEFG_ENTS8      IVFQFPLYTYSCPALLKEWFDRVLSRGFA-----------------------------------------
AZOR_HYPNA      VIIAAPMYNFSVPTSLRSWFDFVLRAGETFKYSE-----AGPEGLLKGKKVVVLTSRG------------
AZOR_HAEIG      LIIGAPMYNLNIPTQLKSYFDFIARPSFQYTAKG-------PEGLLKGKKVIVLCAFG------------
AZOR_DELAS      VVVGAPFYNFTISSQLKAWIDRIAQ--GGRTFRYTAAG---PEGLAKGKKVIVASTRG------------
AZOR_BORPD      IVFAVPVYNFGLPAQLKSYIDQIARAGVTFRYTA----QGVPEGLLKNKQVVVLSARG------------
AZOR4_BURS3     LLIGAPMYNLNVPTQLKNWFDLVARARVTFRYTET-----YPVGLVEGISAIVFSSRGGVHVGQDT----
AZOR3_PSEPF     IVVAAPMYNFTVPTQLKAWIDRIAVAGQTFRYTE-----AGPEGLCGGKKVVIVSTAG------------
AZOR2_BRAJA     VVIGAPMYNFTIPSQLKAWIDRIL----------------------------------------------
AZOR1_XANC5     IVIGAPMYNFAIPSTLKAWIDRI-----------------------------------------------
AZOR1_XANAC     IVIGAPMYNFAIPSTLKAWIDRI-----------------------------------------------
AZOR1_BRAJA     VLISTPMWNFGIPYKLKQWFDIIVQPGLTFRYDPASGY----LPLLKDRPTLVILASGS-----------


                         +         .         .         .         .         *         .:210
query           LPIRRLKRGVFHMCGIYNIVYRRYFAVPFVTDEKRKEFLEDVKKTANNI
NQO2_RAT        GDFRPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVML----------
Y1544_HAEIN     KSLNHLINGLFNYCGIENVEFELFGDIHLIDDKARKAMIE---------
NQO2_PONAB      GDFRPLQHGTLHFCGFKVLAPQISFAPEIASEEERK-------------
NQO2_HUMAN      GDSRPLQHGTLHFCGFKVLAPQISFAPEIASEEERK-------------
NQO1_CAVPO      IILWPIQSGTLHFCGFQVLEPQLTYGIGHTPPDVRTEILAGWKKRLENI
NQO1_PONAB      VILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI
NQO1_RAT        VILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARVQVLEGWKKRLETV
NQO1_MOUSE      VILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETV
NQO2_MOUSE      -------------------------------------------------
NQO1_HUMAN      VILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI
YCAK_ECOLI      -------------------------------------------------
AZOR_BEII9      -------------------------------------------------
AZOR_MYCGA      ADVTVLLKGVFEFIG----------------------------------
AZOR_CLOB8      GIYLRSILGFFGIKDITTISAEKLDVQGENVDKILEEAIDKAKETAKN-
AZOR_SHEON      -------------------------------------------------
AZOR_CLOPS      -------------------------------------------------
AZOR_CLOP1      -------------------------------------------------
AZOR3_BACHD     -------------------------------------------------
AZOR1_COLP3     DYLRHI-------------------------------------------
AZOR_SHESR      -------------------------------------------------
AZOR_SHESM      -------------------------------------------------
AZOR2_CLOPE     -------------------------------------------------
AZOR_BRASB      -------------------------------------------------
AZOR_MYCS5      -------------------------------------------------
AZOR_SHESA      -------------------------------------------------
AZOR_RALSO      FQEAYLKT-VFGFLGITDVQFVR--------------------------
AZOR_FRAP2      -------------------------------------------------
AZOR_BACP2      -------------------------------------------------
AZOR2_COLP3     -------------------------------------------------
AZOR_VIBVU      -------------------------------------------------
AZOR_MYCMO      -------------------------------------------------
AZOR1_BACLD     LNYMKTVMGFFGVQDLHTVVIEGHNAVPDDAQKIIENGLAEAKKLA---
AZOR_PELUB      -------------------------------------------------
AZOR_COPPD      -------------------------------------------------
AZOR_VIBVY      -------------------------------------------------
AZOR_RHOFD      -------------------------------------------------
AZOR_GEOKA      GPAAEMEMG--HR---YLSVIMQFFGVP---------------------
AZOR_RHISN      HQEAYL-RTVFGFFGITDVEFVRAEGLNLGADQKQFAIAEAEKTIA---
AZOR_AZOVD      -------------------------------------------------
AZOR_PSEA6      -------------------------------------------------
AZOR2_PSEPK     -------------------------------------------------
KEFF_SHISS      -------------------------------------------------
AZOR_SHEDO      -------------------------------------------------
AZOR_RHOSK      -------------------------------------------------
AZOR_RHOS4      -------------------------------------------------
AZOR_RHOS1      -------------------------------------------------
AZOR_BACST      GPAAEMEMG--HR---YLSVIMQFFGVP---------------------
AZOR2_CLOAB     -------------------------------------------------
KEFF_ENT38      -------------------------------------------------
AZOR_SHEB9      -------------------------------------------------
AZOR_SHEB8      -------------------------------------------------
AZOR_SHEB2      -------------------------------------------------
AZOR2_BACSU     -------------------------------------------------
KEFG_SALTY      -------------------------------------------------
KEFG_SALTI      -------------------------------------------------
KEFG_SALSV      -------------------------------------------------
KEFG_SALPK      -------------------------------------------------
KEFG_SALPC      -------------------------------------------------
KEFG_SALPB      -------------------------------------------------
KEFG_SALPA      -------------------------------------------------
KEFG_SALNS      -------------------------------------------------
KEFG_SALHS      -------------------------------------------------
KEFG_SALEP      -------------------------------------------------
KEFG_SALDC      -------------------------------------------------
KEFG_SALCH      -------------------------------------------------
KEFG_SALA4      -------------------------------------------------
KEFG_CITK8      -------------------------------------------------
KEFF_SHIFL      -------------------------------------------------
KEFF_SHIF8      -------------------------------------------------
KEFF_SHIDS      -------------------------------------------------
KEFF_SHIBS      -------------------------------------------------
KEFF_SHIB3      -------------------------------------------------
KEFF_ECOLC      -------------------------------------------------
AZOR_THIDA      -------------------------------------------------
AZOR_THICR      -------------------------------------------------
AZOR_SHESH      -------------------------------------------------
AZOR_SHEAM      -------------------------------------------------
AZOR_RHIME      HQETYL-RSVFGFFGITDIEFIRAEGLNLGPDQKQFAIAEAEKTIA---
AZOR_GLUDA      -------------------------------------------------
AZOR_EXISA      -------------------------------------------------
AZOR2_BACHD     MSLNYMKTGFFGVQDPVTVVIEGHNAVPDQAEEIINKGLEEVKKVAQS-
AZOR_SHEFN      -------------------------------------------------
AZOR_BACA2      -------------------------------------------------
AZOR2_PSEPF     -------------------------------------------------
AZOR2_PSEAE     -------------------------------------------------
AZOR1_PSESM     AGHEELLKALFAFIGITDLQFVR--------------------------
KEFG_ENT38      -------------------------------------------------
AZOR_ERYLH      -------------------------------------------------
AZOR_AZOSE      -------------------------------------------------
AZOR_ANATD      -------------------------------------------------
AZOR_AERS4      -------------------------------------------------
AZOR3_PSEAE     -------------------------------------------------
AZOR1_MESFL     -------------------------------------------------
KEFG_SALG2      -------------------------------------------------
AZOR_SHELP      -------------------------------------------------
AZOR_SHEB5      -------------------------------------------------
AZOR2_XANAC     -------------------------------------------------
AZOR2_PSEF5     -------------------------------------------------
AZOR1_IDILO     -------------------------------------------------
AZOR1_HAHCH     --VSAYMRQVLGFIGIKDVTF----------------------------
KEFF_ESCF3      -------------------------------------------------
KEFF_ECOUT      -------------------------------------------------
KEFF_ECOSM      -------------------------------------------------
KEFF_ECOSE      -------------------------------------------------
KEFF_ECOLU      -------------------------------------------------
KEFF_ECOLI      -------------------------------------------------
KEFF_ECOL6      -------------------------------------------------
KEFF_ECOL5      -------------------------------------------------
KEFF_ECOK1      -------------------------------------------------
KEFF_ECOHS      -------------------------------------------------
KEFF_ECODH      -------------------------------------------------
KEFF_ECOBW      -------------------------------------------------
KEFF_ECO8A      -------------------------------------------------
KEFF_ECO81      -------------------------------------------------
KEFF_ECO7I      -------------------------------------------------
KEFF_ECO5E      -------------------------------------------------
KEFF_ECO57      -------------------------------------------------
KEFF_ECO55      -------------------------------------------------
KEFF_ECO45      -------------------------------------------------
KEFF_ECO27      -------------------------------------------------
KEFF_ECO24      -------------------------------------------------
AZOR_VIBPA      -------------------------------------------------
AZOR_SHESW      -------------------------------------------------
AZOR_SHEPC      -------------------------------------------------
AZOR_MYCGE      -------------------------------------------------
AZOR_MACCJ      -------------------------------------------------
AZOR_CHRVO      -------------------------------------------------
AZOR_CALS8      -------------------------------------------------
YRKL_BACSU      -------------------------------------------------
AZOR_STRMK      -------------------------------------------------
AZOR_PSEU2      VGHEELLKALFAFIGITDLQFVR--------------------------
AZOR_METRJ      -------------------------------------------------
AZOR_LEPCP      -------------------------------------------------
AZOR_HAEIE      -------------------------------------------------
AZOR_DIAST      -------------------------------------------------
AZOR_ACISJ      -------------------------------------------------
AZOR5_PSEF5     EDYLKVLFGFF---GITDVEFVRAHGLAY-GEEVRSKAMSDAQ------
AZOR2_XANC5     -------------------------------------------------
AZOR2_HAHCH     -------------------------------------------------
AZOR1_PHOPR     -------------------------------------------------
AZOR1_JANSC     -------------------------------------------------
KEFG_SHIDS      -------------------------------------------------
AZOR1_BACSU     MSLNFMKTGFWGVQDLHTVVIEGHNAAPDQAQEIVEKGLQEAKDLA---
AZOR_SINMW      HQETYL-RSVFGFFGITDIEFIRAEGLNLGADQKQFAIAEAEKTIA---
AZOR_SILPO      -------------------------------------------------
AZOR_PSYIN      -------------------------------------------------
KEFG_SHIFL      -------------------------------------------------
KEFG_SHIF8      -------------------------------------------------
KEFG_ESCF3      -------------------------------------------------
KEFG_ECOUT      -------------------------------------------------
KEFG_ECOSE      -------------------------------------------------
KEFG_ECOLU      -------------------------------------------------
KEFG_ECOLI      -------------------------------------------------
KEFG_ECOLC      -------------------------------------------------
KEFG_ECOL6      -------------------------------------------------
KEFG_ECOK1      -------------------------------------------------
KEFG_ECOHS      -------------------------------------------------
KEFG_ECODH      -------------------------------------------------
KEFG_ECOBW      -------------------------------------------------
KEFG_ECO8A      -------------------------------------------------
KEFG_ECO81      -------------------------------------------------
KEFG_ECO7I      -------------------------------------------------
KEFG_ECO5E      -------------------------------------------------
KEFG_ECO57      -------------------------------------------------
KEFG_ECO55      -------------------------------------------------
KEFG_ECO45      -------------------------------------------------
KEFG_ECO27      -------------------------------------------------
KEFG_ECO24      -------------------------------------------------
AZOR_POLNA      -------------------------------------------------
AZOR_HERAR      -------------------------------------------------
AZOR_ACIC5      -------------------------------------------------
AZOR3_BACCZ     -------------------------------------------------
AZOR2_IDILO     -------------------------------------------------
KEFG_ENTS8      -------------------------------------------------
AZOR_HYPNA      -------------------------------------------------
AZOR_HAEIG      -------------------------------------------------
AZOR_DELAS      -------------------------------------------------
AZOR_BORPD      -------------------------------------------------
AZOR4_BURS3     -------------------------------------------------
AZOR3_PSEPF     -------------------------------------------------
AZOR2_BRAJA     -------------------------------------------------
AZOR1_XANC5     -------------------------------------------------
AZOR1_XANAC     -------------------------------------------------
AZOR1_BRAJA     -------------------------------------------------