[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ22091.1

[Show Plain Result]


## Summary of Sequence Search
    1::388
    6::386     8e-55  34%  387 aa  DHAT_KLEPN RecName: Full=1,3-propanediol dehydrogenase;       
    6::386     5e-51  33%  387 aa  DHAT_CITFR RecName: Full=1,3-propanediol dehydrogenase;       
   10::392     2e-50  33%  402 aa  GBSB_BACSU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   52::422     1e-49  32%  422 aa  ADH4_SCHPO RecName: Full=Alcohol dehydrogenase 4;       
    7::378     2e-48  33%  388 aa  ADH1_CLOSA RecName: Full=NADPH-dependent butanol dehydrogenase;    
   10::379     6e-47  33%  383 aa  ADH2_ZYMMO RecName: Full=Alcohol dehydrogenase 2;       
    9::383     8e-47  32%  383 aa  ADH2_ECOLI RecName: Full=Probable alcohol dehydrogenase;       
    3::381     1e-46  31%  381 aa  MEDH_BACMT RecName: Full=NAD-dependent methanol dehydrogenase;     
   24::355     8e-45  33%  395 aa  EUTG_ECOLI RecName: Full=Ethanolamine utilization protein eutG;    
   11::382     1e-43  31%  383 aa  FUCO_ECOLI RecName: Full=Lactaldehyde reductase;       
   11::382     1e-43  31%  383 aa  FUCO_ECO57 RecName: Full=Lactaldehyde reductase;       
  107::391     4e-38  35%  395 aa  EUTG_SALTY RecName: Full=Ethanolamine utilization protein eutG;    
   10::372     5e-38  28%  382 aa  ADH4_YEAS7 RecName: Full=Alcohol dehydrogenase 4;       
   10::372     3e-37  28%  382 aa  ADH4_YEAST RecName: Full=Alcohol dehydrogenase 4;       
  536::856     1e-31  33%  862 aa  ADHE_CLOAB RecName: Full=Aldehyde-alcohol dehydrogenase;Includes:
   47::460     4e-30  31%  462 aa  HOT_AEDAE RecName: Full=Probable hydroxyacid-oxoacid
    8::305     7e-30  35%  423 aa  MEDH_RHOER RecName: Full=NDMA-dependent methanol dehydrogenase;    
  548::759     2e-28  37%  870 aa  ADH2_ENTHI RecName: Full=Aldehyde-alcohol dehydrogenase 2;Includes:
   51::463     1e-27  28%  466 aa  HOT_BOVIN RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
    1::388     4e-27  28%  389 aa  ADHA_CLOAB RecName: Full=NADH-dependent butanol dehydrogenase A;   
   63::464     2e-26  29%  467 aa  HOT_HUMAN RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
   57::464     1e-25  28%  467 aa  HOT_PONAB RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
   57::464     5e-25  27%  467 aa  HOT_RAT RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
   55::462     5e-25  27%  465 aa  HOT_MOUSE RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
   60::387     1e-24  30%  464 aa  HOT_DROPS RecName: Full=Probable hydroxyacid-oxoacid
    1::390     2e-24  28%  390 aa  ADHB_CLOAB RecName: Full=NADH-dependent butanol dehydrogenase B;   
   49::368     3e-24  29%  464 aa  HOT_ANOGA RecName: Full=Probable hydroxyacid-oxoacid
   53::367     1e-23  28%  463 aa  HOT_XENTR RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
   53::367     1e-23  29%  463 aa  HOT_XENLA RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
  480::847     2e-23  28%  891 aa  ADHE_ECOLI RecName: Full=Aldehyde-alcohol dehydrogenase;Includes:
  480::847     2e-23  28%  891 aa  ADHE_ECO57 RecName: Full=Aldehyde-alcohol dehydrogenase;Includes:
  137::545     5e-23  29%  547 aa  HOT_DICDI RecName: Full=Probable hydroxyacid-oxoacid
   87::348     8e-23  31%  352 aa  TFTE_BURCE RecName: Full=Maleylacetate reductase;       
   49::392     8e-23  29%  464 aa  HOT_DROME RecName: Full=Probable hydroxyacid-oxoacid
   49::463     3e-21  27%  465 aa  HOT_CAEBR RecName: Full=Probable hydroxyacid-oxoacid
   49::357     1e-20  29%  465 aa  HOT_CAEEL RecName: Full=Probable hydroxyacid-oxoacid
   82::274     2e-20  32%  371 aa  4HDB_CLOK5 RecName: Full=NAD-dependent 4-hydroxybutyrate
    1::387     8e-20  27%  387 aa  YUGJ_BACSU RecName: Full=Probable NADH-dependent butanol
   15::348     7e-19  25%  352 aa  TFDF_DELAC RecName: Full=Maleylacetate reductase;       
   15::348     7e-19  25%  352 aa  TCBF_PSESQ RecName: Full=Maleylacetate reductase;       
    1::390     9e-19  27%  390 aa  YUGK_BACSU RecName: Full=Probable NADH-dependent butanol
   55::267     3e-16  29%  352 aa  CLCE_PSEAE RecName: Full=Maleylacetate reductase;       
   89::371     3e-16  30%  387 aa  YQHD_ECOLI RecName: Full=Alcohol dehydrogenase yqhD;       
  117::273     3e-16  31%  359 aa  TFDF2_RALEJ RecName: Full=Maleylacetate reductase 2;       
   55::267     3e-16  29%  352 aa  CLCE_PSESB RecName: Full=Maleylacetate reductase;       
  111::348     5e-15  27%  354 aa  TFDF1_RALEJ RecName: Full=Maleylacetate reductase 1;       
   91::356     6e-12  28%  395 aa  ADH3_ENTHI RecName: Full=Alcohol dehydrogenase 3;       
   85::268     7e-09  33%  367 aa  GLDA_ECOLI RecName: Full=Glycerol dehydrogenase;       
   85::268     7e-09  33%  367 aa  GLDA_ECOL6 RecName: Full=Glycerol dehydrogenase;       
   86::352     1e-07  22%  357 aa  MACA1_RHOOP RecName: Full=Maleylacetate reductase 1;       
   84::190     3e-07  37%  364 aa  GLDA_THEMA RecName: Full=Glycerol dehydrogenase;       
   82::174     3e-06  35%  365 aa  GLDA_PSEPU RecName: Full=Glycerol dehydrogenase;       
    6::174     1e-05  28%  346 aa  G1PDH_PYRHO RecName: Full=Glycerol-1-phosphate dehydrogenase
  110::179     3e-05  31%  365 aa  GLDA_CITFR RecName: Full=Glycerol dehydrogenase;       
    6::174     1e-04  25%  346 aa  G1PDH_PYRFU RecName: Full=Glycerol-1-phosphate dehydrogenase
   10::175     1e-04  28%  350 aa  G1PDH_PICTO RecName: Full=Glycerol-1-phosphate dehydrogenase
  129::218     1e-04  39%  505 aa  SCP47_ARATH RecName: Full=Serine carboxypeptidase-like 47;       
   16::185     3e-04  27%  359 aa  G1PDH_METPE RecName: Full=Glycerol-1-phosphate dehydrogenase
  113::275     5e-04  30%  365 aa  AROB_CHLCH RecName: Full=3-dehydroquinate synthase;       
   70::304     6e-04  32%  335 aa  G1PDH_METJA RecName: Full=Glycerol-1-phosphate dehydrogenase
    1::388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQKYNWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXX
DHAT_KLEPN      ---FDYLVPNVNFFGPNAISVVGERCQLLGGKKALLVTDKGLRKDGAVDKTLHYLREAGIEVAIFDGVEP
DHAT_CITFR      ---FDYLVPNVNFFGPNAISVVGERCKLLGGKKALLVTDKGLRKDGAVDKTLTHLREAGIDVVVFDGVEP
GBSB_BACSU      MQKFHFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEP
ADH4_SCHPO      --------PSFNLFGKGCLAEAAKQIKMSGFKNTLIVTDPGIIKVGLYDKVKALLEEQSITVHLYDGVQP
ADH1_CLOSA      --------PRDIYYGKGSLEQL----KNLKGKKAMLVLGGGMKRFGFVDKVLGYLKEAGIEVKLIEGVEP
ADH2_ZYMMO      ------------FVNEMGEGSLEKAIKDLNFKNALIVSDAFMNKSGVVKQVADLLKAQGINSAVYDGVMP
ADH2_ECOLI      --------PSVNVIGADSLTDAMNMMADYGFTRTLIVTDNMLTKLGMAGDVQKALEERNIFSVIYDGTQP
MEDH_BACMT      ----NFFIPPASVIGRGAVKEVGTRLKQIGAKKALIVTDAFLHSTGLSEEVAKNIREAGLDVAIFPKAQP
EUTG_ECOLI      -----FSVPPVTLCGPGSVSSCGQQAQTRGLKHLFVMADSFLHQAGMTAGLTRSLTVKGIAMTLWPCPVG
FUCO_ECOLI      ----------TAWFGRGAVGALTDEVKRRGYQKALIVTDKTLVQCGVVAKVTDKMDAAGLAWAIYDGVVP
FUCO_ECO57      ----------TAWFGRGAVGALTDEVKRRGYQKALIVTDKTLVQCGVVAKVTDKMDAAGLAWAIYDGVVP
EUTG_SALTY      ----------------------------------------------------------------------
ADH4_YEAS7      --------PPISFFGEGALEETADYIKNKDYKKALIVTDPGIAAIGLSGRVQKMLEERGLNVAIYDKTQP
ADH4_YEAST      --------PPISFFGEGALEETADYIKNKDYKKALIVTDPGIAAIGLSGRVQKMLEERDLNVAIYDKTQP
ADHE_CLOAB      ----------------------------------------------------------------------
HOT_AEDAE       ---------STIRYGPGVSKELGHDLQNLNAKNVCIVTDRNVAKLNSVKVAFDSLTRCGIQYQVYDETRV
MEDH_RHOER      -----WDFPALMGVGAHDIIGVEA--KNLGFKRTLLMT-TGLRGSGIIEELVGKIEYQGVEVVLYDKVES
ADH2_ENTHI      ----------------------------------------------------------------------
HOT_BOVIN       ---------STIRYGAGVTKEVGMDLQSMGAKNVCLMTDKNLSQLPPVQTVMDSLVKNGINFKVYDHVRV
ADHA_CLOAB      MLSFDYSIPTKVFFGKGKIDVIGEEIKKYGSRVLIVYGGGSIKRNGIYDRATAILKENNIAFYELSGVEP
HOT_HUMAN       --------------------EVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRV
HOT_PONAB       --------------GAGVTKEVGMDLQNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRV
HOT_RAT         --------------GAGVTKEVGMDLQNMGAKNVCLMTDKNLSQLPPVQIVMDSLSKNGISFQVYDNVRV
HOT_MOUSE       --------------GAGVTKEVGMDLQNMGAKNVCLMTDKNLSQLPPVQIVMDSLSKNGISFQVYDDVRV
HOT_DROPS       --------------------EVGADLRNLGAKKVCLVTDRNVAKLPSVKVALDSLARHGINYEVYDETRV
ADHB_CLOAB      MVDFEYSIPTRIFFGKDKINVLGRELKKYGSKVLIVYGGGSIKRNGIYDKAVSILEKNSIKFYELAGVEP
HOT_ANOGA       ---------STIRYGPGVTRELGHDLQNLGAKSVCVVSDRNVLQLPSVKVGLDAIVRAGIEPVLFDAVRV
HOT_XENTR       --------------GENVTQEIGMDLQNLGARNVCVMTDRNLVELSPVKAVLNSLVKNNVSFKLYDRVRV
HOT_XENLA       --------------GENVTQEIGMDLQNWGTRNVCVMTDRNLSELSPVKAVLNSLVKNGINFKLYDSVRV
ADHE_ECOLI      -------------------------------KRALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEA
ADHE_ECO57      -------------------------------KRALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEA
HOT_DICDI       ---------------------------DMNCRNVIVFTDNNLLKLVAVAKCLYSLEKCGIKYTIYSDVSI
TFTE_BURCE      ----------------------------------------------------------------------
HOT_DROME       ---------STVRFGPGVSAEVGADLRNLGARKVCLVTDKNVVQLPSVKVALDSLARNGINYEVYDETRV
HOT_CAEBR       ---------STLRFGKGVTLEIGYDVRNLGAKKTLLITDKNVQNTIAFKNAEQALKMVNIEYEIFDDVLI
HOT_CAEEL       ---------STLRFGKGVTLEIGYDVRNLGAKKTLLITDKNVQNTIAFKNAEQALKMVNIEYEVFDDVLI
4HDB_CLOK5      ----------------------------------------------------------------------
YUGJ_BACSU      MQNFTYWNPTKLIFGRGEVERLPEELKPYG-KNVLLVYGGGIKRSGLYDQVIEQLNKAGATVHELAGVEP
TFDF_DELAC      --------------GAGRLQSLGEELKLLGIRRVLVISTP--EQRELANQVAALIP--GSVAGFFDRATM
TCBF_PSESQ      --------------GAGRLQSLGEELKLLGIRRVLVISTP--EQRELANQVAALIP--GSVAGFFDRATM
YUGK_BACSU      MENFTYYNPTKLIFGKGQLEQLRKEFKRYG-KNVLLVYGGGIKRNGLYDQVTGILKEEGAVVHELSGVEP
CLCE_PSEAE      ----------------------------------------------------------GHVAAFYDGATM
YQHD_ECOLI      ----------------------------------------------------------------------
TFDF2_RALEJ     ----------------------------------------------------------------------
CLCE_PSESB      ----------------------------------------------------------GHVAAFYDGATM
TFDF1_RALEJ     ----------------------------------------------------------------------
ADH3_ENTHI      ----------------------------------------------------------------------
GLDA_ECOLI      ----------------------------------------------------------------------
GLDA_ECOL6      ----------------------------------------------------------------------
MACA1_RHOOP     ----------------------------------------------------------------------
GLDA_THEMA      ----------------------------------------------------------------------
GLDA_PSEPU      ----------------------------------------------------------------------
G1PDH_PYRHO     -------FPREVILGKNLIQEINNVIKRLKLGSPGLVVYGPITKKIAGSNVEKIVKEE---FEVYSITVK
GLDA_CITFR      ----------------------------------------------------------------------
G1PDH_PYRFU     -------FPREVILGKNVISETVNVAKRLSFSSPVLVVYGPKTKEIAGKDVERVLKEE---FDVHSVIVK
G1PDH_PICTO     ------HFPSDVYIGHDAILNIGSVVKFLKSGEVLLITGEN-TYNIAGKKVLSNLNDFDVNVIIASRATR
SCP47_ARATH     ----------------------------------------------------------------------
G1PDH_METPE     --KSKWQLPRDVVIGHNALDQFPAVCQDLKIGRSVMLFAGKSTMQVAGNRIEELLAPSFDISTFLARELT
AROB_CHLCH      ----------------------------------------------------------------------
G1PDH_METJA     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIA
DHAT_KLEPN      NPKDTNVRDGLAVFRREQCDIIVTVGGGSPHDCGKGIGIAATHEGDLYQYAGI-----ETLTNPLPPIVA
DHAT_CITFR      NPKDTNVRDGLEVFRKEHCDIIVTVGGGSPHDCGKGIGIAATHEGDLYSYAGI-----ETLTNPLPPIVA
GBSB_BACSU      NPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGK--KPLENRIPPLTT
ADH4_SCHPO      NPTVGNVNQGLEIVKKENCDSMVSIGGGSAHDCAKGIALLATNGGKIADYEGVDKS-----SKPQLPLIA
ADH1_CLOSA      DPSVETVFKGAELMRQFEPDWIIAMGGGSPIDAAKAMWIFYEH--PEKTFDDIKDPFTVPELRNKAKFLA
ADH2_ZYMMO      NPTVTAVLEGLKILKDNNSDFVISLGGGSPHDCAKAIALVATNGGEVKDYEGIDKSKKPA-----LPLMS
ADH2_ECOLI      NPTTENVAAGLKLLKENNCDSVISLGGGSPHDCAKGIALVAANGGDIRDYEGV-DRSAKPQ----LPMIA
MEDH_BACMT      DPADTQVHEGVDVFKQENCDALVSIGGGSSHDTAKAIGLVAANGGRINDYQGVN-----SVEKXXXXXXX
EUTG_ECOLI      EPCITDVCAAVAQLRESGCDGVIAFGGGSVLDAAKAVTLLVTN--PDSTLAEMSE--TSVLQPRL-PLIA
FUCO_ECOLI      NPTITVVKEGLGVFQNSGADYLIAIGGGSPQDTCKAIGIIS--NNP--EFADVREGLSPTNKPSV-PILA
FUCO_ECO57      NPTITVVKEGLGVFQNSGADYLIAIGGGSPQDTCKAIGIIS--NNP--EFADVREGLSPTNKPSV-PILA
EUTG_SALTY      ------------------CDGVVAFGGGSXXXXXXXXXXXXTN--PDQTLSAMTEHSTLRPR---LPLIA
ADH4_YEAS7      NPNIANVTAGLKVLKEQNSEIVVSIGGGSAHDNAKAIALLATNGGEIGDYEGVNQSKKAA-----LPLFA
ADH4_YEAST      NPNIANVTAGLKVLKEQNSEIVVSIGGGSAHDNAKAIALLATNGGEIGDYEGVNQSKKAA-----LPLFA
ADHE_CLOAB      -------------------DTIIALGGTPEMSSAKLMWVLYEH--PEVKFEDLAIKYTFPKLGKKAMLVA
HOT_AEDAE       EPTDQSLLHAAEYARQNKFDSFVAIGGGSVIDTCKANLFSADREAEFLDYVNAPIGKAKEVNVKLKPLIA
MEDH_RHOER      NPKDYNVMEAAALYQKEKCDXXXXXXXXXXHDAAKGARVVDGRNIN--EFEGFAKSTNKENP----PHIA
ADH2_ENTHI      -------------------DNIIAIGGGSAMDAAKIMWLLYEH--PEADFFAMKQKFIDLRKGKKARLIC
HOT_BOVIN       EPTDTSFMEAIEFAKKGAFDAFLAVGGGSTIDTCKAALYSSSPDSDFLDYVNAPIGKGKPVTVPLKPLIA
ADHA_CLOAB      NPRITTVKKGIEICRENNVDLVLAIGGGSAIDCSKVIAAGVYYDGDTWDMVKDPSKITK-----VLPIAS
HOT_HUMAN       EPTDSSFMEAIEFAQKGAFDAYVAVGGGSTMDTCKAALYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIA
HOT_PONAB       EPTDASFMEAIEFAQKGAFDAYVAVGGGSTMDTCMAALYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIA
HOT_RAT         EPTDGSFMDAIEFAKKGAFDAYVAVGGGSTMDTCKAALYACSPHSEFLDYVNAPIGKGKPVTVPLKPLIA
HOT_MOUSE       EPTDGSFMDAIEFAKKGAFDAYVAVGGGSTMDTCKAALYASSPHSEFLDYVNAPIGKGKPVTVPLKPLIA
HOT_DROPS       EPTDASLWHAADYARQNEFDAFLAIGGGSVMDTAKAALFSSDREAEFLDYVNCPIGKGKEISVKLKPLIA
ADHB_CLOAB      NPRVTTVEKGVKICRENGVEVVLAIGGGSAIDCAKVIAAACEYDGNPWDIVLDG-----SKIKRVLPIAS
HOT_ANOGA       EPTNESLQTAIDFARSHRFDAFVAIGGGSAIDTCKANLYSADREAEFLDYVNVPIGRAKEVTVPLKPLIA
HOT_XENTR       EPTDKSFMDAIEFAKKGQFDAYVGVGGGSVIDTCKAALYSSSPGADFLDYVNPPIGKGKAVTVPLKPLIA
HOT_XENLA       EPTDKSFMDAIEFAKKGQFDAFVAVGGGSVIDTCKAALYSSSPDSDFLDYVNPPIGKGKAVTVPLKPLIA
ADHE_ECOLI      DPTLSIVRKGAELANSFKPDVIIALGGGSPMDAAKIMWVMYEH--PETHFEELALRFMDIRKRIYAKMIA
ADHE_ECO57      DPTLSIVRKGAELANSFKPDVIIALGGGSPMDAAKIMWVMYEH--PETHFEELALRFMDIRKRIYAKMIA
HOT_DICDI       EPTDTSFKDAISVMGKGRYDGVVAVGGGSVMDTAKAANLYNSYPPADNDFPPIGKGLLVPGPLK-RPLIA
TFTE_BURCE      -------------------DCAVAIGGGSTTGLGKAIALESG-----------------------LPILS
HOT_DROME       EPTDGSMWHAVEFARGKEFDAFLAIGGGSAMDTAKAALFSSDANAEFLDYVNCPIGRGKEISVKLKPLIA
HOT_CAEBR       EPSEKSMQKAIAFAKSKPFDSFIAVGGGSVIDTTKAAALYASN--PEADFLDVGPPFGKSLQPKMLPLIA
HOT_CAEEL       EPTVNSMQKAIAFAKSKQFDSFIAVGGGSVIDTTKAAALYASN--PEADFLDVGPPFGKSMQPKMLPLIA
4HDB_CLOK5      ---------------------IIAVGGGSVIDIAKILSLKTDDSLDLFE--------GKVPLVKNKELII
YUGJ_BACSU      NPRVSTVNKGVAICKEQNIDFLLAVGGGSVIDCTKAIAAGAKYDGDAWDIV------TKKHQPKDAPFGT
TFDF_DELAC      HVPSQIVDQAASVARELGVDSYVAPGGGSTIGLAKMLALHSS-----------------------LPIVA
TCBF_PSESQ      HVPSQIVDQAASVARELGVDSYVAPGGGSTIGLAKMLALHSS-----------------------LPIVA
YUGK_BACSU      NPRLATVEKGIGLCREHDIDFLLAVGGGSVIDCTKAIAAGVKYDGDAWDIFS-----KKVTAEDALPFGT
CLCE_PSEAE      HVPALVAEEACKIARTSEANGVIAIGGGSTIGLAKIVALRTE-----------------------LPIVA
YQHD_ECOLI      ---------------------LLAVGGGSVLDGTKFIAAAANENIDPWHILQTGGKEIKS----AIPMGC
TFDF2_RALEJ     --------------------------------------------------------------------VA
CLCE_PSESB      HVPALVAEEACKIARTSEANGVIAIGGGSTIGLAKIVALRTE-----------------------LPIVA
TFDF1_RALEJ     ------------------------------------------------------------------PSLV
ADH3_ENTHI      ---------------------LVAVGGGSIIDATKYIALGMEHTYS----DDPYDICLKGGKFKVNPAQA
GLDA_ECOLI      ------------------CGAILGIGGGKTLDTAKALAHFMG-----------------------VPVAI
GLDA_ECOL6      ------------------CGAILGIGGGKTLDTAKALAHFMG-----------------------VPVAI
MACA1_RHOOP     --------------RTSEADCVVAIGGGSTTGLAKALAARTGVDQVILPTTYAGSEVTPVLGETVE----
GLDA_THEMA      -------------------DVVVGIGGGKTLDTAKAVAYKLKK-----------------------PVVI
GLDA_PSEPU      ---------------QNGRSAIVGIGGGKTLDTAKAVAF----------FQKV-------------PVAV
G1PDH_PYRHO     EAHINEVERVISKIRDKGIKWAIAVGGGSIIDVTKLASFKMG-----------------------IPFIS
GLDA_CITFR      ------------------------------------------------------------------PVVV
G1PDH_PYRFU     EATINEVEKVEGIIRDNKVKWAIAVGGGTIIDVTKLASYRAG-----------------------IPFVS
G1PDH_PICTO     DSI-----KSIEESLKNRRSGIVGVGGGSKIDIAKKIAY------------DLG-----------IPFIS
SCP47_ARATH     ---------------------VIWLTGGPGCSSSVAMFYENG---PFKISKDLSLYWNDFGWDKVSNIIY
G1PDH_METPE     PESMKEGEEAAC-----GVDLIIGVGGGRVIDTAKIVSF----NLDL-------------------PFIS
AROB_CHLCH      ------------------------------------------------------------------PVIQ
G1PDH_METJA     -------------------DCVIGIGGGRSIDTGKYLAYKLG-----------------------IPFIS


                         +         .         .         .         .         *         .:210
query           VPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEAYCA
DHAT_KLEPN      VNTTAGTASEVTRHCVLTNTETKVKFVIVSWRNLPSVSINDPLLMIGKPAALTAATGMDALTHAVEAYIS
DHAT_CITFR      VNTTAGTASEVTRHCVLTNTKTKVKFVIVSWRNLPSVSINDPLLMLGKPAPLTAATGMDALTHAVEAYIS
GBSB_BACSU      IPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTM
ADH4_SCHPO      INTTAGTASEMTRFAIITEETRHIKMAIIDKHTMPILSVNDPETMYGLPPSLTAATGMDALTHAVEAYVS
ADH1_CLOSA      IPSTSGTATEVTAFSVITDYKTEIKYPLADFNITPDVAVVDSELAETMPPKLTAHTGMDALTHAIEAYVA
ADH2_ZYMMO      INTTAGTASEMTRFCIITDEVRHVKMAIVDRHVTPMVSVNDPLLMVGMPKGLTAATGMDALTHAFEAYSS
ADH2_ECOLI      INTTAGTASEMTRFCIITDEARHIKMAIVDKHVTPLLSVNDSSLMIGMPKSLTAATGMDALTHAIEAYVS
MEDH_BACMT      XXXXXXXXXXXXXLAVITDSARKVKMPVIDEKITPTVAIVDPELMVKKPAGLTIATGMDALSHAIEAYVA
EUTG_ECOLI      IPTTAGTGSETTNVTVIIDAVSGRKQVLAHASLMPDVAILDAALTEGVPSHVTAMTGIDALTHAIEAYSA
FUCO_ECOLI      IPTTAGTAAEVTINYVITDEEKRRKFVCVDPHDIPQVAFIDADMMDGMPPALKAATGVDALTHAIEGYIT
FUCO_ECO57      IPTTAGTAAEVTINYVITDEEKRRKFVCVDPHDIPQVAFIDADMMDGMPPALKAATGVDALTHAIEGYIT
EUTG_SALTY      VPTTAGTGSETTNVTVIIDAVSGRKQVLAHASLMPDVAILDAAVTEGVPPNVTAMTGIDALTHAIEAYSA
ADH4_YEAS7      INTTAGTASEMTRFTIISNEEKKIKMAIIDNNVTPAVAVNDPSTMFXXXXXXXXXXXXXXXXHCIEAYVS
ADH4_YEAST      INTTAGTASEMTRFTIISNEEKKIKMAIIDNNVTPAVAVNDPSTMFXXXXXXXXXXXXXXXXHCIEAYVS
ADHE_CLOAB      ITTSAGSGSEVTPFALVTDNNTGNKYMLADYEMTPNMAIVDAELMMKMPKGLTAYSGIDALVNSIEAYTS
HOT_AEDAE       VPTTAGTGSETTGVVIFLHAKTGISS-----KYLPQLGLIDPLHTLSQPEKVAAYCGFDVFCHALESFTA
MEDH_RHOER      VSTTAGTGSETSWAYVITDTSNPHKWVGFDEATIVTLAIDDPLLYYTCPQHFTAYCGFDVLAHGSEPFVS
ADH2_ENTHI      IPTTSGTGSEVTPFAVISDHETGKKYPLADYSLTPSVAIVDPMFTMSLPKRAIADTGLDVLVHATEAYVS
HOT_BOVIN       VPXXXXXXXXXXXVAIFDYEHLKVKTGIASRAIKPTLGLIDPLHTLHMPERVVANSGFDVLCHALESYTA
ADHA_CLOAB      ILTLSATGSEMDQIAVISNMETNEKLGVGHDDMRPKFSVLDPTYTFTVPKNQTAAGTADIMSHTFESYFS
HOT_HUMAN       VPXXXXXXXXXXXVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTT
HOT_PONAB       VPXXXXXXXXXXXVAIFDYEHLKVKIGIASRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTT
HOT_RAT         VPXXXXXXXXXXXVAIFDYEHLKVKTGIASRAIKPTLGLVDPLHTLHMPCQVVANSGFDVLCHALESYTA
HOT_MOUSE       VPXXXXXXXXXXXVAIFDYEHLKVKTGIASRAIKPTLGLVDPLHTLHMPCQVVANSGFDVLCHALESYTA
HOT_DROPS       MPXXXXXXXXXXXVAIFDYKRLHAKTGISSKYLKPTLAIIDPLHTLSQPERVMAFAGFDVFCHALESFTA
ADHB_CLOAB      ILTIAATGSEMDTWAVINNMDTNEKLIAAHPDMAPKFSILDPTYTYTVPTNQTAAGTADIMSHIFEVYFS
HOT_ANOGA       VPTTAGTGSETTGVAIFDHKPLHAKTGISSKALRPILGLVDPLHTLSQPEKVAAYCGFDVFCHALESFTA
HOT_XENTR       VPXXXXXXXXXXXIAIFDYEELKAKTGIASRAIKPTLGLIDPVHTLSMPERVVANSGFDVLCHSLESYTA
HOT_XENLA       VPXXXXXXXXXXXIAIFDYEELKAKTGIASRAIKPTLGLIDPAHTLSMPERVVANSGFDVLCHSLESYTA
ADHE_ECOLI      XXXXXXXXXXXXPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHAMEAYVS
ADHE_ECO57      XXXXXXXXXXXXPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHAMEAYVS
HOT_DICDI       IPTTCGTASETTGVCILLGDGLSAKTGIASRHLKPILGLVDPDNLLTLPSNVAISSGFDQLCHALESFTA
TFTE_BURCE      IPTTYAGSEMTPIYGVTDN---GVKQTGRDARVLPRTVIYDPELTLGLPIRMTVSSGLNAIAHAAESLYA
HOT_DROME       MPXXXXXXXXXXXVAIFLHAKTGISS-----KFLPTLAVIDPLHTLSQPQRVMAFAGFDVFCHALESFTA
HOT_CAEBR       VPXXXXXXXXXXXXXIMDLPEHKCKTGIRLRCIKPYLAVVDPLNVMSMPRNVAIYSGFDVLCHALESYTA
HOT_CAEEL       VPXXXXXXXXXXXXXIMDLPEHKCKTGIRLRCIKPYLAVVDPLNVMSMPRNVAIYSGFDVLCHALESFTA
4HDB_CLOK5      VPTTCGTGSEVTNVSVAELKRRHTKKGIASDELYATYAVLVPEFIKGLPYKFFVTSSVDALIHATEAYVS
YUGJ_BACSU      VLTLAATGSEMNSGSVITNWETKEKYGWGSPLVFPKFSILDPVNTFTVPKNHTIYGMVDMMSHVFEQY--
TFDF_DELAC      IPTTYAGSEMTSIYGVTENE---LKKTGRDRRVLARTVIYDPELTFGLPTGISVTSGLNAIAHAVEGLYA
TCBF_PSESQ      IPTTYAGSEMTSIYGVTENE---LKKTGRDRRVLARTVIYDPELTFGLPTGISVTSGLNAIAHAVEGLYA
YUGK_BACSU      VLTLAATGSEMNPDSVITNWETNEKFVVTHPRF----SILDPENTFTVPENQTVYGMVDMMSHVFEQY--
CLCE_PSEAE      VPTTYA-GSEM--TSIFGITEGGVKKTGRDARVMPRAVIYEPRLTLELPLSISVTSAINAIAHAVEGLYA
YQHD_ECOLI      VLTLPATGSESNAGAVISRKTTGDKQAFHSAHVQPVFAVLDPVYTYTLPPRQVANGVVDAFVHTVEQYVT
TFDF2_RALEJ     LPTTYAGSEMTPIWGLTAD---GAKRTGRDPRVLPSTVLYDPHHLTSLPPEVTGPSGMNAIAHAVESMYA
CLCE_PSESB      VPTTYA-GSEM--TSIFGITEGGVKKTGRDARVMPRAVIYEPRLTLELPLSISVTSAINAIAHAVEGLYA
TFDF1_RALEJ     IPTTYAGSEMTTIWGVT---EGGMKRTGRDPKVLPKTVIYDPLLTVDLPLAISVTSALNAIAHAAEGLYS
ADH3_ENTHI      VLTIPATGSETNCWGVISRHADKLKLPFNNESVFPTWSIVDPCFTMSLPDNQIRNGLVDSFVHCIEQYIG
GLDA_ECOLI      APTIASTDAPCSALSVIYTDEGEFDRYLLLPNN-PNMVIVDTKIVAGAPARLLAAGIGDALATWFEARAC
GLDA_ECOL6      APTIASTDAPCSALSVIYTDEGEFDRYLLLPNN-PNMVIVDTKIVAGAPARLLAAGIGDALATWFEARAC
MACA1_RHOOP     -------GRKTTRSTLAV---------------LPETVIYDVELSKNLPVPIXXXXXXXXXXXXXXXMYS
GLDA_THEMA      VPTIASTDAPCSALSVIYTPNGEFKRYLFLPR-NPDVVLVDTEIVAKAPARFLVAGMGDALATWFEASCK
GLDA_PSEPU      APTIASTDAPCSALSVLYTDEGEFDRYLMLPT-NPALVVVDTAIVARAPARLLAAGIGDALA--------
G1PDH_PYRHO     FPTTASDGIASANASIKLNVKTSI-------KAKPPIAVIADIDVIKTAPKRYLAAGVGDIVSNITA---
GLDA_CITFR      IPTIASTDAPTSALSVIYTEAGEFEEYLIYPK-NPDMVVMDTAIIAKAPVRLLVAGMGDALSTWFEA---
G1PDH_PYRFU     FPTTASDGIASANASI---KGLGTKTSI---KARPPVAVIADIRIIKSAPRRYLAAGVGDVISNITA---
G1PDH_PICTO     VPTTSHDGIASPRASIY-----DGKSVYSEEATMPSAIVADTSIMVLAPYRYVAAGAADVISN-------
SCP47_ARATH     VDQPVGTGSYTSDESDIRNDEDGVSNDLYHPKFV------------------------------------
G1PDH_METPE     VPTAASDGIASGRASLQTSE--GSASLTAHP---PLGVVADTGIIAAAPHRLLAAGCADIISN-------
AROB_CHLCH      MPTTAMTDSAIG-GKVAINHPLG-KNLIFH---LPELVLIDPATLASLPRREIYAGLAEVVKYGFIA--D
G1PDH_METJA     VPTTA---SNDGIASPIVS--------IRQPSFMPIAIIADTEIIKKSPRRLLSA-GMGDIVSNITAYKE


                         .         .         .         +         .         .         .:280
query           PGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTAFQKGLGAIHSLSHPVNALNNIH
DHAT_KLEPN      KDANPVTDAAAMQAIRLIARNLRQAVALGSNLQARENMAYASLLAGMAFNNNLGYVHAMAHQLGGLYDMP
DHAT_CITFR      KDANPVTDXXXXXXXXXXXXXXXQAVALGSNLKARENMAYASLLAGMAFNNNLGYVHAMAHQLGGLYDMP
GBSB_BACSU      KFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYSESAGAAHAMSQTLGGIIPVA
ADH4_SCHPO      TAANPITDACAVKCIELVNKYLKRAVDNGKDEEARDNMAYAEFLGGMAFNNSLGYVHAMAHQLGGFYGIP
ADH1_CLOSA      TLHSPFTDPLAMQAIEMINEHLFKSYEGDK--EAREQMHYAQCLAGMAFSNALGICHSMAHKTGAVFHIP
ADH2_ZYMMO      TAATPITDACALKAASMIAKNLKTACDNGKDMPAREAMAYAQFLAGMAFNNSLGYVHAMAHQLGGYYNLP
ADH2_ECOLI      IAATPITDACALKAVTMIAENLPLAVEDGSNAKAREAMAYAQFLAGMAFNNSLGYVHAMAHQLGGFYNLP
MEDH_BACMT      KGATPVTDAFAIQAMKLINEYLPKAVANGEDIEAREAMAYAQYMAGVAFNNGLGLVHSISHQVGGVYKLQ
EUTG_ECOLI      LNATPFTDSLAIGAIAMIGKSLPKAVGYGHDLAARESMLLASCMAGMAFSSGLGLCHAMAHQPGAALHIP
FUCO_ECOLI      RGAWALTDALHIKAIEIIAGALRGSVAGDKDAGEEMALQYVAGMGFS--NVGLGLVHGMAHPLGAFYNTP
FUCO_ECO57      RGAWALTDALHIKAIEIIAGALRGSVAGDKDAGEEMALQYVAGMGFS--NVGLGLVHGMAHPLGAFYNTP
EUTG_SALTY      LNATPFTDSLAIGAIAMIGKSLPKAVGYGHDLAARENMLLASCMAGMAFSSGLGLCHAMAHQPGAALHIP
ADH4_YEAS7      TASNPITDACALKGIDLINESLVAAYKDGKDKKARTDMCYAEYLAGMAFNNSLGYVHALAHQLGGFYHLP
ADH4_YEAST      TASNPITDACALKGIDLINESLVAAYKDGKDKKARTDMCYAEYLAGMAFNNSLGYVHALAHQLGGFYHLP
ADHE_CLOAB      VYASEYTNGLALEAIRLIFKYLPEAYKNGTNEKAREKMAHASTMGMASANAFLGLCHSMAIKLSSEHNIP
HOT_AEDAE       QGSNPISDVWARFALKIIRENFISAVFNQDDLKARSNMHLASTMAGVGFNAGVHLCHGLSYPISGHVKIP
MEDH_RHOER      RLDFAPSLGNAIYSVELVAKNLREAVFEPRNLKAREGMMNAQYIAGQAFNSGLGIVHSISHAVSAFFDSH
ADH2_ENTHI      VMANEYTDGLAREAVKLVFENLLK--SYNGDLEAREKMHNAATIAGMAFASALGMDHSMAHKVGAAFHLP
HOT_BOVIN       LPYHPISDIWAVHALRIVAKYLKRAIRNPDDLEARSNMHLASAFAGIGFNAGVHLCHGMSYPISGLVKVP
ADHA_CLOAB      EGAY-VQDGIAEAILRTCIKYGKIAMEKTDDYEARANLMWASSLAINGL-LSLGSCHPMEHELSAYYDIT
HOT_HUMAN       LPYHPISDIWAIHALRIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFNAGVHLCHGMSYPISGLVKMY
HOT_PONAB       LPYHPISDIWAIHALRIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFNAGVHLCHGMSYPISGLVKVP
HOT_RAT         QGSNPISDIWAVHALRIVAKYLKRAVRNPDDLEARSSMHLASAFAGIGFNAGVHLCHGMSYPISGLVKVP
HOT_MOUSE       QGSNPISDIWAVHALQIVAKYLKRAVRNPDDLEARSKMHLASAFAGIGFNAGVHLCHGMSYPISGLVKVP
HOT_DROPS       VDYNPISDVWARFALETIRKNFINAIYEPGNLEARSQMHLASTMAGVGFNAGVHLCHGLSYPISGVRNIP
ADHB_CLOAB      TAY--LQDRMAEALLRTCIKYGGIALEKPDDYEARANLMWASSLGLLTYGKDTNSVHLMEHELSAYYDIT
HOT_ANOGA       QGSNPISDVWARFALQTISRHFRRAVYAPDDLEARSQMHLASTMAGVGFNAGVHLCHGLSYPIAGLVKIP
HOT_XENTR       QGSNPISDVWAKHALRIVAKYLKRAVRNPDDREARFAMHLASSFAGVGFNAGVHLCHGMSYPIAGHVKVP
HOT_XENLA       QGSNPISDVWAKHALRIVAKFLKRAVRNPDDREARFAMHLASSFAGVGFNAGVHLCHGMSYPIAGHVKVP
ADHE_ECOLI      VLASEFSDGQALQALKLLKEYLPASYHEGSNPVARERVHSXXXXXXXXXXXXLGVCHSMAHKLGSQFHIP
ADHE_ECO57      VLASEFSDGQALQALKLLKEYLPASYHEGSNPVARERVHSXXXXXXXXXXXXLGVCHSMAHKLGSQFHIP
HOT_DICDI       QGANPVSDVWSLRSLEMLCKNIHRFVLNPNDDYARSQMMLAASYAGLGFNSGVHACHGMSYSISSMNLIP
TFTE_BURCE      HDGNPVIGLMAEEGIRAIGAALTPLQANPADLVARSDALYGAWLGAVLGAVSMGLHHKLCHTLGGAFNLP
HOT_DROME       VDYNPVSDVWARFALETIRKNFVNAIYQPDNLEARSQMHLASTMAGVGFNAGVHLCHGLSYPISGNVRIP
HOT_CAEBR       QGSNPISDVWSREALRIIGQYFRRSVFDPSDEEARTEMLKASSFAGIGFNAGVHLCHGLSYPISSKNLIP
HOT_CAEEL       QGSNPISDVWSKEALRIIGKYFRRSIFDPTDEEARTEMLKASSFAGIGFNAGVHLCHGLSYPISSKNLIP
4HDB_CLOK5      PNANPYTDMFSVKAMELILNGYMQMVEKGNDVEIIEDFVIGSNYAGIAFNAGVGAVHALSYPIGGNYHVP
YUGJ_BACSU      --FHPYQDRMCESLLRTVIETAPKLINDLENYELRETILYTGTIALNGMARGDWATHNIEHAVSAVYDIP
TFDF_DELAC      PEVNPILAIMAQQGIAALAKSIPTIRSAPTDLEARSQAQYGAWLGSVLGNVSMALHHKLCHTLGGTFNLP
TCBF_PSESQ      PEVNPILAIMAQQGIAALAKSIPTIRSAPTDLEARSQAQYGAWLGSVLGNVSMALHHKLCHTLGGTFNLP
YUGK_BACSU      --FHPLQDRMCFAVLQTVIETAPKLLEDLENYELRETILYAGTIALNGTLQGDWASHTMEHAVSAVYDIP
CLCE_PSEAE      PDATPLLTIMAQEGIAATVRAISRMYQSPRDLQARGDALYGAWLASVVGNVSMALHHKLCHTLGGTLDLP
YQHD_ECOLI      KPVDAKIQDRFAEGILLT---LIEALKEPENYDVRANVMWAATQALNGL-IGAGATHMLGHELTAMHGLD
TFDF2_RALEJ     PDRNPITMLLAEESIRAMAQGLPVAVDSPGDLDARTRTLYAAWLAGTVLMVSMGLHHKLCHVLGGRFNLP
CLCE_PSESB      PDATPLLTIMAQEGIAATVRAISRMYQSPRDLQARGDALYGAWLASVLGNVSMALHHKLCHTLGGTLDLP
TFDF1_RALEJ     ADLNPVLETMCKQGICALFDAIPRLVAKPTDAEARTDALFGAWMCGTALHLGMGLHHKLCHTLGGTLNLP
ADH3_ENTHI      -NYHPVVEAETEGVMRTIIGVSHKTLENHQDYQARMSLLCGVTLCGGAHAVGVGGAHAVGHELTSYYGLA
GLDA_ECOLI      SGATTMAGGAALALAELCYNTLLEE-GEKAMLAAEQHVVTPAYLSGVGFESGLAAAHAVHNGLTAIPDAH
GLDA_ECOL6      SGATTMAGGAALALAELCYNTLLEE-GEKAMLAAEQHVVTPAYLSGVGFESGLAAAHAVHNGLTAIPDAH
MACA1_RHOOP     PDANPVVDTWXXXXXXXXXXXXXXXVSDPSCRRIRTDLLRGSWLGMCLGSVGMAVHHKLCHTLGGAFGLP
GLDA_THEMA      QKYAPNMTG-------------------------------------------------------------
GLDA_PSEPU      ----------------------------------------------------------------------
G1PDH_PYRHO     ----------------------------------------------------------------------
GLDA_CITFR      ----------------------------------------------------------------------
G1PDH_PYRFU     ----------------------------------------------------------------------
G1PDH_PICTO     ----------------------------------------------------------------------
SCP47_ARATH     ----------------------------------------------------------------------
G1PDH_METPE     ----------------------------------------------------------------------
AROB_CHLCH      ANFFDMLEAHFSEVATLQEPYLTEAVKTSALI--KQDVVTRDFRELDGLRATLNFGHTFAHGLEKLADYR
G1PDH_METJA     KG-EKYSESSAIFS-KTIAKELISYVLN-SDLSEYHNKLVKALVGS-----GIAAIANSSRPASGSEHLF


                         .         *         .         .         .         .         +:350
query           HGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDID
DHAT_KLEPN      HGVANAVLLPHVARYN--LIANP-EKFADIAELMGENITGLIAAITRLSMDIGIPQHLRD-LGVKEADFP
DHAT_CITFR      HGVANAVLLPHVARYN--LIANP-EKFADIAEFMGENTDGLIHAIARLSADIGIPQHLRD-LGVKEADFP
GBSB_BACSU      HGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGITEEAAKASVNWMYDLVEDLEVP-TLEEQGVSPDM-IE
ADH4_SCHPO      HGVCNAVLLAHVQKFNRDPRANRLGDIAFHLGCEEHTAEAALDRISQLVLEVKIPHLVDLGVKEKDFDV-
ADH1_CLOSA      HGCANAIYLPYVIKFNSKTSLERYAKIAKQISLNEELVDSLINLVKELNKKMQIPTTLKEYIHEQEFKVD
ADH2_ZYMMO      HGVCNAVLLPHVLAYNASVVAGRLKDVLDIANLGDKGAEATIQAVRDLAASIGIPANLTELGAKKE-DVP
ADH2_ECOLI      HGVCNAVLLPHVQVFNSKVXXXXXXXXXXXMGVNAEGAEACINAIRELAKKVDIPAGLRDLVKEEDFAV-
MEDH_BACMT      HGICNSVNMPHVCAFN---LIAKTERFAHIAELLGENVSGLSTXXXXYNKNFGIPSGYAE-MGVKEEDIE
EUTG_ECOLI      HGLANAMLLPTVMEFNRMVCRERFSQIGRALRTKKSDDRDAINAVSELIAEVGIGKRLGDV---------
FUCO_ECOLI      HGVANAILLPHVMRYNADFTGEKYRDIARVMGVKEEARNAAVEAVFALNRDVGIPPHLRDVGVRKE-DIP
FUCO_ECO57      HGVANAILLPHVMRYNADFTGEKYRDIARVMGVKEEARNAAVEAVFALNRDVGIPPHLRDVGVRKE-DIP
EUTG_SALTY      HGQANAMLLPTVMGFNRMVCRERFSQIGRALTNKKSDDRDAIAAVCELIAEVGQSKRLADA-GAKPEHYS
ADH4_YEAS7      HGVCNAVLLPHVQEANMQCAKKRLGEIALHFGASQEDPEETIKALHVLNRTMNIPRNLKELVKTEDFEI-
ADH4_YEAST      HGVCNAVLLPHVQEANMQCAKKRLGEIALHFGASQEDPEETIKALHVLNRTMNIPRNLKELVKTEDFEI-
ADHE_CLOAB      SGIANALLIEEVIKFN--AVDNPVARIADYIKLDEEKVDLLINKIHELKKALNIPTSIKDVLEENFYSLD
HOT_AEDAE       HGLSVVMTAPAVFKFTAASCPERHLEAAELLSKANRNDAGSI--LSDVVRQYMYKLKIENGLDSLGFDIQ
MEDH_RHOER      HGLNNAIALPRVWEYN------------------------------------------------------
ADH2_ENTHI      HGRCVAVLLPHVIRYN------------------------------------------------------
HOT_BOVIN       HGLSVVLTSPAVFTFTSQMFPERHLEVAEILGADTRTADAGPVLADTLRKDLDVDDGLA-AIGYSKADIP
ADHA_CLOAB      HGVGLAILTPYIL--NDDTL-HKFVSYGINVWGIDKNKDNYIKNTREYFNSLGIPSKLREVGIGKD-KLE
HOT_HUMAN       HGLSVVLTSPAVFTFTAQMFPERHLEMAEILGADTRTADAGLVLADTLRKDLDVDDGLAAVGYSK-ADIP
HOT_PONAB       HGLSVVLTSPAVFTFTAQMFPERHLETAEILGADTRTADAGLVLADTLRKDLDVDDGLAAVGYSK-ADIP
HOT_RAT         HGLSVVLTSPAVFTFTAQMFPERHLETAEILGANIRTADAGPVLADALRKDLNVDDGLAALGYSKD-DIP
HOT_MOUSE       HGLSVVLTSPAVFTFTAQMFPERHLETAGILGANIRTADAGLVLADALRKDLNVDDGLAALGYSKD-DIP
HOT_DROPS       HGLSVVISAPAVFEFTAPACPDRHLEAAKLLGAK------------------------------------
ADHB_CLOAB      HGVGLAILTPYIL--NNDTVYKGIDKEKNHYDIAHQAIDYFVN-------VLGLPSRLRDVIEEEKLDIM
HOT_ANOGA       HGLSVVMTAPSVFRF-------------------------------------------------------
HOT_XENTR       HGLSVVLTSPAVFSF-------------------------------------------------------
HOT_XENLA       HGLSVVLTSPAVFSF-------------------------------------------------------
ADHE_ECOLI      HGLANALLICNVIRYNRPQARRRYAEIADHLGLSDRTIEKLLAWLETLKAELGIPKSIREAVQEADFNVD
ADHE_ECO57      HGLANALLICNVIRYNRPQARRRYAEIADHLGLSDRTIEKLLAWLETLKAELGIPKSIREAVQEADFNVD
HOT_DICDI       HGQSVILSAPAVFKFTAPSNPERHLLLAKIMDISNASESDLSNQIVKLMKLLNVPNGL-QALGYKESDID
TFTE_BURCE      HAELHTVILPHALAYNSARASQAMERIARALGVSSAP-----RGLFDLAERSGLPVSLAALGMPRE-GIE
HOT_DROME       HGLSVVISAPAVFEFTAPACPDRHLEAAQLLGAEVRGVE-------------------------------
HOT_CAEBR       HGLSVMTTAVADFEFTTAACPDRHLVAAQTLDIPNNADNEYISRTLGFMKDFGVPNGLKGMGFEYS-DID
HOT_CAEEL       HGLS------------------------------------------------------------------
4HDB_CLOK5      HGEANYLF--------------------------------------------------------------
YUGJ_BACSU      HAGGLAILFPHTLSENPARMKQLAVRVFDVEEAEEIALEG-IDKLSAFWTSLGAPNRLAD-YDINDEQLD
TFDF_DELAC      HAETHTVVLPHALAYNTPAIPRANAWLQEALATREPA-----QALFDLAKSNGAPVSL-QSIGMKEADLD
TCBF_PSESQ      HAETHTVVLPHALAYNTPAIPRANAWLQEALATREPA-----QALFDLAKSNGAPVSL-QSIGMKEADLD
YUGK_BACSU      HAGGLAILFPYTLDTNVGRFKNLMLNMFDIKTDKEIALEG-IDKLSAFWTSLGAPSRLADIGEEK---LE
CLCE_PSEAE      HAQTHTVVLPHALAYN------------------------------------------------------
YQHD_ECOLI      HAQTLAIVLPALWNEKRDTKRAKLLQYAERVGSDDERIDAAIAATRNFFEQLGVPTHLS------DYGLD
TFDF2_RALEJ     HAPMHAVLLPHVAAFNE-----------------------------------------------------
CLCE_PSESB      HAQTHTVVLPHALAYN------------------------------------------------------
TFDF1_RALEJ     HAETHAI-----VXXXXXXXXXXXXXXXERLLQEVAGSSDVPSALYDLARNAGAPLSLAE-IGMRPEDIP
ADH3_ENTHI      HGETLAITTPGVMRFNKEKNAKKLIQMGEQVGIKNSTPEAAIEATEKWFKSIGMKTRLSE----------
GLDA_ECOLI      H---------------------------------------------------------------------
GLDA_ECOL6      H---------------------------------------------------------------------
MACA1_RHOOP     HAPTHTVVLPYAMSFNASEVPDVMDSLASAMNVSNAPAG-----VWDLIADAGGPTSLAS-LGLLQTDLD
GLDA_THEMA      ----------------------------------------------------------------------
GLDA_PSEPU      ----------------------------------------------------------------------
G1PDH_PYRHO     ----------------------------------------------------------------------
GLDA_CITFR      ----------------------------------------------------------------------
G1PDH_PYRFU     ----------------------------------------------------------------------
G1PDH_PICTO     ----------------------------------------------------------------------
SCP47_ARATH     ----------------------------------------------------------------------
G1PDH_METPE     ----------------------------------------------------------------------
AROB_CHLCH      HGLVCALYLSHRLGF-------------------------------------------------------
G1PDH_METJA     SHALDKLKEEYNLNINSLHGEQCGIGMMSYLEKENKKLSGLHEKIKMSLKKVDAPTTAKELGFDEDIIIE


                         .         .         .         .         *         .         .:420
query           RLSKMALADPSTGGNPKKLTEDDMRIMYQNSMTGExxx
DHAT_KLEPN      YMAEMALKDGNAFSNPRKGNEQEIAAIFRQA-------
DHAT_CITFR      YMAEMALKDGNAFSNPRKGNEKEIAEIFRQA-------
GBSB_BACSU      RLSKEAMKDPQTFGNPRDLNEKAYNWIYK---------
ADH4_SCHPO      -LVDHAMKDACGATNPIQPTHDEVKAIFKSAM------
ADH1_CLOSA      LISERAIGDACTGSNPRQLNKDEMKKIFE---------
ADH2_ZYMMO      LLADHALKDACALTNPRQGDQKEVEELF----------
ADH2_ECOLI      -LATNALKDACGFTNPIQATHEEIVAIYRAAM------
MEDH_BACMT      LLAKNAFEDVCTQSNPRVATVQDIAQIIKNAL------
EUTG_ECOLI      --------------------------------------
FUCO_ECOLI      ALAQAALDDVCTGGNPREATLEDIVELYHTA-------
FUCO_ECO57      ALAQAALDDVCTGGNPREATLEDIVELYHTA-------
EUTG_SALTY      AWAQAALEDICLRSNPRTATQAQIIDLY----------
ADH4_YEAS7      -LAEHAMHDACHLTNPVQFTKEQV--------------
ADH4_YEAST      -LAEHAMHDACHLTNPVQFTKEQV--------------
ADHE_CLOAB      RISELALDDQCTGANPRFPLTSEIKEMYIN--------
HOT_AEDAE       SLVKGTLQERITKLAPRAQTEEDLASLFENSMT-----
MEDH_RHOER      --------------------------------------
ADH2_ENTHI      --------------------------------------
HOT_BOVIN       ELVKGTLQERVTKLAPRPQSEEDLSALFEASM------
ADHA_CLOAB      LMAKQAVRNSGTIGSLRPINAEDVLEIFKKS-------
HOT_HUMAN       ALVKGTLQERVTKLAPCPQSEEDLAALFEASM------
HOT_PONAB       ALVKGTLQERVTKLAPRPQSEEDLAALFEASM------
HOT_RAT         SLVKGTLQERVTKLAPRAQSEEDLSALFEASM------
HOT_MOUSE       SLVKGTLQERVTKLAPRAQSEEDLSALFEASM------
HOT_DROPS       --------------------------------------
ADHB_CLOAB      AKESVKLTG-GTIGNLRPVNASEVLQIFKKSV------
HOT_ANOGA       --------------------------------------
HOT_XENTR       --------------------------------------
HOT_XENLA       --------------------------------------
ADHE_ECOLI      KLSEDAFDDQCTGANPR---------------------
ADHE_ECO57      KLSEDAFDDQCTGANPR---------------------
HOT_DICDI       SLVKGTLPQHRTKLMPKQATYDDLYKLFKDSMT-----
TFTE_BURCE      LAADMAVKNPYP--NPRPLERDAIRVLLEHAYDG----
HOT_DROME       --------------------------------------
HOT_CAEBR       HLTEAASSVPNIVISPKSTDRDIISKLYEKSLT-----
HOT_CAEEL       --------------------------------------
4HDB_CLOK5      --------------------------------------
YUGJ_BACSU      TIADKAMAN-GTFGQFKSLNKEDVLSILKASL------
TFDF_DELAC      RACELVMS--AQYPNPRPLEKHAIANLLRRAYLGE---
TCBF_PSESQ      RACELVMS--AQYPNPRPLEKHAIANLLRRAYLGE---
YUGK_BACSU      LIADIAAKEMEHGGNFQKLNKDDVLAILRASL------
CLCE_PSEAE      --------------------------------------
YQHD_ECOLI      GSSIPALL--------KKLEEHGMTQLGEN--------
TFDF2_RALEJ     --------------------------------------
CLCE_PSESB      --------------------------------------
TFDF1_RALEJ     RVRDLALRDQYP--NPRPLESDALETLLVNAFRG----
ADH3_ENTHI      --------------------------------------
GLDA_ECOLI      --------------------------------------
GLDA_ECOL6      --------------------------------------
MACA1_RHOOP     RAADLATEAPYR--NPRQITRSGIRDLLQSAWEG----
GLDA_THEMA      --------------------------------------
GLDA_PSEPU      --------------------------------------
G1PDH_PYRHO     --------------------------------------
GLDA_CITFR      --------------------------------------
G1PDH_PYRFU     --------------------------------------
G1PDH_PICTO     --------------------------------------
SCP47_ARATH     --------------------------------------
G1PDH_METPE     --------------------------------------
AROB_CHLCH      --------------------------------------
G1PDH_METJA     ALT-----------------------------------