[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ22111.1

[Show Plain Result]


## Summary of Sequence Search
    1::284
    4::221     6e-31  36%  228 aa  GLXC_RHIME RecName: Full=Protein glxC;
    9::171     9e-14  36%  261 aa  Y1350_METJA RecName: Full=Uncharacterized protein MJ1350;
   60::180     5e-12  37%  273 aa  FWDC_METJA RecName: Full=Tungsten-containing formylmethanofuran
  103::198     1e-09  39%  301 aa  FMDC_METBF RecName: Full=Molybdenum-containing formylmethanofuran
   78::161     2e-08  34%  272 aa  FWDC_METMP RecName: Full=Tungsten-containing formylmethanofuran
   81::166     3e-08  32%  270 aa  FWDC_METTH RecName: Full=Tungsten-containing formylmethanofuran
  195::269     5e-08  39%  306 aa  Y238_METTH RecName: Full=Uncharacterized protein MTH_238;
   81::166     7e-08  32%  270 aa  FWDC_METWO RecName: Full=Tungsten-containing formylmethanofuran
  147::213     7e-08  39%  270 aa  FWDC_METTM RecName: Full=Tungsten-containing formylmethanofuran
 1332::1460    8e-07  30% 1556 aa  GLTS_SYNY3 RecName: Full=Ferredoxin-dependent glutamate synthase 2;  
  204::281     1e-06  32%  318 aa  Y658_METJA RecName: Full=Uncharacterized protein MJ0658;
 1294::1437    6e-05  31% 1550 aa  GLTB_SYNY3 RecName: Full=Ferredoxin-dependent glutamate synthase 1;  
   89::133     7e-05  36%  400 aa  FMDC_METWO RecName: Full=Molybdenum-containing formylmethanofuran
   89::133     7e-05  36%  400 aa  FMDC_METTM RecName: Full=Molybdenum-containing formylmethanofuran
   89::133     7e-05  36%  400 aa  FMDC_METTH RecName: Full=Molybdenum-containing formylmethanofuran
 1291::1419    1e-04  30% 1517 aa  GLTB_SPIOL RecName: Full=Ferredoxin-dependent glutamate synthase,
 1301::1420    1e-04  32% 1517 aa  GLTB_ECOLI RecName: Full=Glutamate synthase [NADPH] large chain;     
 1275::1398    1e-04  30% 1520 aa  GLTA_BACSU RecName: Full=Glutamate synthase [NADPH] large chain;     
 1329::1457    2e-04  28% 1549 aa  GLTB_CYACA RecName: Full=Ferredoxin-dependent glutamate synthase;    
 1268::1445    5e-04  29% 1538 aa  GLTB_PORPU RecName: Full=Ferredoxin-dependent glutamate synthase;    
 1354::1465    8e-04  36% 2145 aa  GLT1_YEAST RecName: Full=Glutamate synthase [NADH];       
    1::284

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLDVKDMTAPEANKEI
GLXC_RHIME      -------------------------------------------------------IDLATTPLREFNRSL
Y1350_METJA     -------------------------------------------------------IDAKDMHYRELNEKI
FWDC_METJA      ----------------------------------------------------------------------
FMDC_METBF      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METTH      ----------------------------------------------------------------------
Y238_METTH      ----------------------------------------------------------------------
FWDC_METWO      ----------------------------------------------------------------------
FWDC_METTM      ----------------------------------------------------------------------
GLTS_SYNY3      ----------------------------------------------------------------------
Y658_METJA      ----------------------------------------------------------------------
GLTB_SYNY3      ----------------------------------------------------------------------
FMDC_METWO      ----------------------------------------------------------------------
FMDC_METTM      ----------------------------------------------------------------------
FMDC_METTH      ----------------------------------------------------------------------
GLTB_SPIOL      ----------------------------------------------------------------------
GLTB_ECOLI      ----------------------------------------------------------------------
GLTA_BACSU      ----------------------------------------------------------------------
GLTB_CYACA      ----------------------------------------------------------------------
GLTB_PORPU      -------------------------------------------------------MDDDILAIPEINDAI
GLT1_YEAST      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DNLMSQGFGTIVIKNPQGKHSLGVGILNKLNLIFEGSLGYFGMGSCDGPTVRINGRVGWSCAENLMAGKV
GLXC_RHIME      HNIQ-QGSNDLSVANPRGSHAVAVGIDGPVVVDVNGSVGYYCAGMNDGGTVTVHGSAGPGVAENMMSGKV
Y1350_METJA     HEILRENIKKIVLKNVLGQRFIADGIQKK-DLTIEGDLGMF----MSGPTIIVHGNAEFAPGNTMDDGTI
FWDC_METJA      -----EGEPRIVIKNSSPKLKYIGSKMTKGEIVVEGDAGMYVGAEMKGGKIVVNGNAESWAGQNMKGGEL
FMDC_METBF      -----------------------------------------------GDAMRIK-RIG----ESMSAGKI
FWDC_METMP      --------------------------------------------------------------EKMTSGEI
FWDC_METTH      --------------------------------------------------------------QDMTAGEI
Y238_METTH      -----------------------------------------------------HGNVDLSTGILMRRGTV
FWDC_METWO      --------------------------------------------------------------QEMTAGEI
FWDC_METTM      ----------------------------------------------------------------MSGGVI
GLTS_SYNY3      ------------------------GFEGNITLNFQGAAGQFGAFNLDGMTLHLQGEANDYVGKGMNGGEI
Y658_METJA      -------------------------------------------------TIVVNGDVDLSTGILMRKGKV
GLTB_SYNY3      --------GTIVGNEITKRHWEGLPE-DTVHLHFQGSAGQFGAFIPKGMTLELEGDANDYLGKGLSGGKI
FMDC_METWO      ----------------------------------------------------------------------
FMDC_METTM      ----------------------------------------------------------------------
FMDC_METTH      ----------------------------------------------------------------------
GLTB_SPIOL      ------------------------GFAGQLNLTFEGSAGQFAVFLTPGMNIRLVGESNDYVGKGMAGGEL
GLTB_ECOLI      ---------------------------------FNGTAGQFGVWNAGGVELYLTGDANDYVGKGMAGGLI
GLTA_BACSU      -----------------------------IKLHFTGSAGQFGAFVPKGMTLYLDGDSNDYVGKGLSGGKI
GLTB_CYACA      ------------------------GFRGSLILNFYGTAGQFGSFNIKGVTLRLIGEANDYVGKSMSGGEI
GLTB_PORPU      ENEVAKHFKIANTNRTVGTRLSGVGFKGLIKLNFYGSAGQFGAFLASGVNLKLMGEANDYVGKGMNGGSI
GLT1_YEAST      ----------------------------------EGSAGQFGAFLASGITFILNGDANDYVGKGLSGGII


                         +         .         .         .         .         *         .:210
query           VIEKNAGSCFGAAIRGGDLICKGSVGARTGIDMKGGTIIVGGDAGAFTGFMMQRGRIIILGDVGINLGDS
GLXC_RHIME      VIEGDASQYAGATGRGGLLVIKGNAASRCGISMKGIDIVVHGNIGHMSAFMGQSGHLVVLGDAGDALGDS
Y1350_METJA     VIYGSSGDVTAHSMRGGKVFVRGDVGYRSGIHMKAPVLVIGGRAKDFLGEYMAGGIIIVLNEKGNDLG--
FWDC_METJA      LIKGNAGDYVGSAYRGD---WRG---------MSGGTIIVEGNAGNEIGEFMSKGLIHIKGNVGIMAG--
FMDC_METBF      EIEGSAGMHVGTGMKGGELVVYGDADSWAGMEMTGGLLHIKGNAGDHVGCAMKGGRIVIEGSARHQLGGG
FWDC_METMP      VVNGDAGMYIGVEMKGGKITVNGDAESWVGQNLKGGEIIINGNAENYVGSAMSGGKITITGNAGSELGE-
FWDC_METTH      LVKGNVNMYVGAGMKGGKITVEGNAKSWAGQDMRGGELEIFGDAGDYVGSSMSGGVITVHGNAGNEIGEY
Y238_METTH      RVMGDAGKNTGALLSGGTVIIQGDCDDFSGIDMRDGYLIVDGDAGKFLG-AQRRGGVIL-----------
FWDC_METWO      IVRGNVNMYVGAGMKGGKITVEGNAGSWAGQDMRGGEIEILGDADDYVGSSMSGGTITVHGNADNEIGEY
FWDC_METTM      TVHGNAGNEIGEYMNGGKIIIKGDVNIMPGIHMNNGLIIIEGNAVARVGGEMAGGTIIVKG---------
GLTS_SYNY3      VIVPHPQASFAPGATGGNLYANGRAGERFAVRNSVGKAVIEG-AGDHCCEYMTGGVIVVLGPVGRNVGAG
Y658_METJA      IVNGNAGKNTGAVLXXXXXXXXXXXXDFTGFEMRDGIIVVDGNAGKYLGAKKKEGVI-------------
GLTB_SYNY3      IVYPPKGSSFIASATAGEVYISGMVGERFCVRNSGVNTVVEGDHGC---EYMTGGKVVVLGQTGRNFAAG
FMDC_METWO      ----DVGLQLGCEMKGGEIEVNGNVSSWIGMEMHGGTIKINGNAGDYVG---------------------
FMDC_METTM      ----DVGLQLGCEMKGGEIEVNGNVSSWIGMEMHGGTIKINGNAGDYVG---------------------
FMDC_METTH      ----DVGLQLGCEMKGGEIEVNGNVSSWIGMEMHGGTIKINGNAGDYVG---------------------
GLTB_SPIOL      IVAENPGTCLYGA-TGGQIFVRGKAGERFAVRNSLAEAVVEG-TGDHCCEYMTGGCVVILGKVGRNVAAG
GLTB_ECOLI      AIRPPVGSAFRSGATGGRLYAAGRAGERFGVRNSGATVVEGGDNGCE---YMTGGIVCILGKTGVNFGAG
GLTA_BACSU      IVKSSEGAFYGAT--SGEAYINGRAGERFAVRNSGVNVVVEG-IGDHGCEYMTGGSVVVLGDVGKNFAAG
GLTB_CYACA      VIVPPSEVAFDASEQGGFLFAYGAAGERFAVRNSNAFSVLEG-VGDHACEYMTGGRVVVLGKAGRNIAAG
GLTB_PORPU      IIVPPAGTTYGAT--GGYLFAQGQAGERFAVRNSLAKSVVEG-VGDHACEYMTGGTIVVLGKAGRNVGAG
GLT1_YEAST      VIKPPKDSCFYGATSGTAFI-SGSAGERFGVRNSGATIVVERIKGNNAFEYMTGGRAIVLSQM-------


                         .         .         .         +         .         .         .:280
query           MYDXXXXXXXXXXXXXXDAVPADLTASDQDWLKRKLKVAEIGEKFDVSKMTKIVAGKKLWNYDxxxxxxx
GLXC_RHIME      LYEAKLFVRGTVKSLGADCIEKEMRP------EHLQKLAELLEKADVEEFKRYGSARKLYNFN-------
Y1350_METJA     ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
FMDC_METBF      M---------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METTH      M---------------------------------------------------------------------
Y238_METTH      ----------------------------------------------------------------------
FWDC_METWO      M---------------------------------------------------------------------
FWDC_METTM      ----------------------------------------------------------------------
GLTS_SYNY3      M---------------------------------------------------------------------
Y658_METJA      ----------------------------------------------------------------------
GLTB_SYNY3      M---------------------------------------------------------------------
FMDC_METWO      ----------------------------------------------------------------------
FMDC_METTM      ----------------------------------------------------------------------
FMDC_METTH      ----------------------------------------------------------------------
GLTB_SPIOL      M---------------------------------------------------------------------
GLTB_ECOLI      M---------------------------------------------------------------------
GLTA_BACSU      M---------------------------------------------------------------------
GLTB_CYACA      M---------------------------------------------------------------------
GLTB_PORPU      M---------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxx
GLXC_RHIME      ----
Y1350_METJA     ----
FWDC_METJA      ----
FMDC_METBF      ----
FWDC_METMP      ----
FWDC_METTH      ----
Y238_METTH      ----
FWDC_METWO      ----
FWDC_METTM      ----
GLTS_SYNY3      ----
Y658_METJA      ----
GLTB_SYNY3      ----
FMDC_METWO      ----
FMDC_METTM      ----
FMDC_METTH      ----
GLTB_SPIOL      ----
GLTB_ECOLI      ----
GLTA_BACSU      ----
GLTB_CYACA      ----
GLTB_PORPU      ----
GLT1_YEAST      ----