[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ22162.1

[Show Plain Result]


## Summary of Sequence Search
    1::342
  175::324     4e-06  32%  345 aa  LIVM_METJA RecName: Full=Probable branched-chain amino acid
  169::282     1e-05  38%  323 aa  RBSC_HAEIN RecName: Full=Ribose transport system permease protein
  288::377     2e-04  22%  425 aa  LIVM_ECOLI RecName: Full=High-affinity branched-chain amino acid
  154::209     0.001  30%  319 aa  YUFQ_BACSU RecName: Full=Uncharacterized ABC transporter permease
    1::342

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LIVM_METJA      ----------------------------------------------------------------------
RBSC_HAEIN      ----------------------------------------------------------------------
LIVM_ECOLI      ----------------------------------------------------------------------
YUFQ_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LIVM_METJA      ----------------------------------------------------------------------
RBSC_HAEIN      ----------------------------------------------------------------------
LIVM_ECOLI      ----------------------------------------------------------------------
YUFQ_BACSU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxGMTVPVWPKDLGSNASSSQFMYYLSFGLAVITFITLKWAYSTRFGLILNAIRDNEDKAEAMG
LIVM_METJA      -----------------------------------IAFLVYLFFERLLNTPFGRVLRAMRENENTVKAFG
RBSC_HAEIN      --------GIPVPIW---------------IMSIVFAVAWYI-LK---DTPIGRYIYALGGNEAATQLSG
LIVM_ECOLI      ----------------------------------------------------GRAWEALREDEIACRSLG
YUFQ_BACSU      ----------------------------VYYTSILAIALAFISWFILFKTPFGLRIRSVGEHPMAADTMG


                         .         .         .         +         .         .         .:280
query           IHTMRYKIIGWMVSAFFVGIAGGLMGHINGYIEPNEIAFAGPTFGVFMVLMAILGGKGTLWGPLVGAVLF
LIVM_METJA      RDIMKLRIKTMXXXXXXXXXXXVLYSLYTVNIIAN--AFTRVDWTFFPFLMVLLGGKGNNKGVALGVVLL
RBSC_HAEIN      INVNKIKVFVFAVSGFLSALA--------GLIVTSRLSSAQPTAGVSYELDAIMGGKGRVMGTLIGALI-
LIVM_ECOLI      LSPRRIKLTAFTISXXXXXXXXXXXXXRQGFVSPESFTFAE---SAFVLAIVVLGGMGSQFAVILAAILL
YUFQ_BACSU      INVYKMRYIGVMIS--------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           HLFKEGFWTYFLGWQYVALGVLXXXXXXYFPEGLxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LIVM_METJA      DIYKYNI-KYALGWSYMLFGVLMLLILYYKPSGL----------------------------
RBSC_HAEIN      --------------------------------------------------------------
LIVM_ECOLI      VVSRE---------------------------------------------------------
YUFQ_BACSU      --------------------------------------------------------------