[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ20846.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e5nA.bssp"
#ERROR : Can't open dsspfile "1ehiA.bssp"
#ERROR : Can't open dsspfile "1e4eA.bssp"
#ERROR : Can't open dsspfile "1e4eB.bssp"
#ERROR : Can't open dsspfile "1a9xA.bssp"
#ERROR : Can't open dsspfile "1ehiB.bssp"
#ERROR : Can't open dsspfile "1c30A.bssp"
#ERROR : Can't open dsspfile "1bxrA.bssp"
#ERROR : Can't open dsspfile "1ce8A.bssp"
#ERROR : Can't open dsspfile "1b6sB.bssp"
#ERROR : Can't open dsspfile "3bg5A.bssp"
#ERROR : Can't open dsspfile "2c00B.bssp"
#ERROR : Can't open dsspfile "1bncA.bssp"
#ERROR : Can't open dsspfile "3bg5B.bssp"
#ERROR : Can't open dsspfile "1dv1A.bssp"
#ERROR : Can't open dsspfile "3df7A.bssp"
#ERROR : Can't open dsspfile "1dv2A.bssp"
#ERROR : Can't open dsspfile "2dzdB.bssp"
#ERROR : Can't open dsspfile "1auvB.bssp"
#ERROR : Can't open dsspfile "3bg5D.bssp"
#ERROR : Can't open dsspfile "1bncB.bssp"
#ERROR : Can't open dsspfile "3d8tA.bssp"
#ERROR : Can't open dsspfile "1dv2B.bssp"
#ERROR : Can't open dsspfile "2dzdA.bssp"
#ERROR : Can't open dsspfile "2c00A.bssp"
#ERROR : Can't open dsspfile "1dv1B.bssp"
#ERROR : Can't open dsspfile "3d8rA.bssp"
#ERROR : Can't open dsspfile "3bg5C.bssp"
#ERROR : Can't open dsspfile "2czgA.bssp"
#ERROR : Can't open dsspfile "1auvA.bssp"
#ERROR : Can't open dsspfile "3d8tB.bssp"
#ERROR : Can't open dsspfile "2dxcF.bssp"
#ERROR : Can't open dsspfile "1b6sC.bssp"
#ERROR : Can't open dsspfile "3d8nA.bssp"
#ERROR : Can't open dsspfile "1b6sA.bssp"
#ERROR : Can't open dsspfile "2dwcB.bssp"
#ERROR : Can't open dsspfile "2czgB.bssp"
#ERROR : Can't open dsspfile "2dwcA.bssp"
#ERROR : Can't open dsspfile "2dd4C.bssp"
#ERROR : Can't open dsspfile "1b6rA.bssp"
#ERROR : Can't open dsspfile "2dd4F.bssp"
#ERROR : Can't open dsspfile "1auxA.bssp"
#ERROR : Can't open dsspfile "1cqjB.bssp"
#ERROR : Can't open dsspfile "2cqyA.bssp"
#ERROR : Can't open dsspfile "2bv8B.bssp"
#ERROR : Can't open dsspfile "2bjqA.bssp"
#ERROR : Can't open dsspfile "3czxA.bssp"
#ERROR : Can't open dsspfile "1dosA.bssp"

## Summary of PDB Search
:304
    1e-37  26%  3e5nA  [x.x.x] D-ALANINE-D-ALANINE LIGASE A
    5e-34  23%  1ehiA  [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
    7e-33  30%  1e4eA  [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
    1e-31  29%  1e4eB  [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
    5e-30  18%  1a9xA  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    1e-29  24%  1ehiB  [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
    2e-29  14%  1c30A  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    7e-29  18%  1bxrA  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    2e-28  17%  1ce8A  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    2e-26  12%  1b6sB  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    1e-25  16%  3bg5A  [x.x.x] PYRUVATE CARBOXYLASE
    1e-25  17%  2c00B  [x.x.x] BIOTIN CARBOXYLASE
    2e-23  14%  1bncA  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    6e-23   9%  3bg5B  [x.x.x] PYRUVATE CARBOXYLASE
    2e-22  16%  1dv1A  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    2e-22  15%  3df7A  [x.x.x] PUTATIVE ATP-GRASP SUPERFAMILY PROTEIN
    3e-22  17%  1dv2A  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    1e-21  15%  2dzdB  [x.x.x] PYRUVATE CARBOXYLASE
    1e-21  11%  1auvB  [c.30.1 - d.142.1] SYNAPSIN IA
    1e-21  10%  3bg5D  [x.x.x] PYRUVATE CARBOXYLASE
    2e-21  14%  1bncB  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    2e-21  10%  3d8tA  [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
    6e-21  16%  1dv2B  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    1e-20  15%  2dzdA  [x.x.x] PYRUVATE CARBOXYLASE
    2e-20  15%  2c00A  [x.x.x] BIOTIN CARBOXYLASE
    2e-20  14%  1dv1B  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    3e-20   9%  3d8rA  [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
    4e-20  14%  3bg5C  [x.x.x] PYRUVATE CARBOXYLASE
    6e-20  15%  2czgA  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    2e-19  11%  1auvA  [c.30.1 - d.142.1] SYNAPSIN IA
    4e-19  10%  3d8tB  [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
    1e-18  13%  2dxcF  [x.x.x] THIOCYANATE HYDROLASE SUBUNIT GAMMA
    2e-18  11%  1b6sC  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    3e-17  11%  3d8nA  [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
    4e-17  12%  1b6sA  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    1e-16  16%  2dwcB  [x.x.x] 433AA LONG HYPOTHETICAL
    2e-15  12%  2czgB  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    4e-15  12%  2dwcA  [x.x.x] 433AA LONG HYPOTHETICAL
    1e-14  14%  2dd4C  [x.x.x] THIOCYANATE HYDROLASE GAMMA SUBUNIT
    5e-14  10%  1b6rA  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    9e-14  14%  2dd4F  [x.x.x] THIOCYANATE HYDROLASE GAMMA SUBUNIT
    9e-14  13%  1auxA  [c.30.1 - d.142.1] SYNAPSIN IA
    2e-13  13%  1cqjB  [d.142.1 - c.23.4] SUCCINYL-COA SYNTHETASE BETA CHAIN
    1e-08  21%  2cqyA  [x.x.x] PROPIONYL-COA CARBOXYLASE ALPHA CHAIN,
    1e-07  15%  2bv8B  [x.x.x] C-PHYCOCYANIN BETA SUBUNIT
    1e-06   9%  2bjqA  [x.x.x] MFP2A
    1e-06  12%  3czxA  [x.x.x] PUTATIVE N-ACETYLMURAMOYL-L-ALANINE AMIDASE
    6e-04   8%  1dosA  [c.1.10] ALDOLASE CLASS II
:304

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTKKILILSGGISKERLISLDTGKQVAKELIKNGYKVLISEPDKNLSKNITSFKPDVIFNALHGQFGEDG
3e5nA           --IRVGLIFGGKSAEHEVSLQSARNILDALDPQRFEPVLIGIDKQGQWHVNDPDSDVVFPIVHGTLGEDG
1ehiA           --KRVALIFGGNSSEHDVSKRSAQNFYNAIEATGKYEIIVFAIAQIHALKSAGDFDIFFPVVHGNLGEDG
1e4eA           --IKVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLYIGITKSKNHEYEINHVDVAFSALHGKSGEDG
1e4eB           --IKVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLYIGITKSKNHEYEINHVDVAFSALHGKSGEDG
1a9xA           --KSILILGAGPIVIGQACDYSGAQACKALREEGYRVINVNSNPAVRKIIEKERPDAVLPTMGGQTALEL
1ehiB           --KRVALIFGGNSSEHDVSKRSAQNFYNAIEATGKYEVFAIAQNRIHALKSAGDFDIFFPVVHGNLGEDG
1c30A           TDREKIMVLGGGPNRIGQGIEFDVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVQYGGQTPL
1bxrA           --KSILILGAGPIVIGQACDYSGAQACKALREEGYRVILVNSNPAVRKIIEKERPDAVLPTMGGQTALNC
1ce8A           --KSILILGAGPIVIGQACDYSGAQACKALREEGYRVINVNSNPAVRKIIEKERPDAVLPTTALNCALEL
1b6sB           --KQVCVLGNGQLGRMLR------QAGEPLGIAVWPVGL-DAEPA---------AVPFQQSVITAEIERW
3bg5A           --KKLLVARGEISNEDKSSLHRYKADESYLVGSDLGPAESYLNIERIIDVAKQANVDAIHPGYGFLSENE
2c00B           MLEKVLIANRGEI---------ALRILRACKELGIKAVHSTADRQIPAIIAAAEVTGAIHPGYGFLAENA
1bncA           MLDKIVIANRGEIALRILRASSADRDLKHVLLADETVCIGPAPSVKSYLNIPAIIAVAIHPGYGFLSENA
3bg5B           ------------------------------------------------------------------NEDK
1dv1A           --DKIVIANRG---EI------ALRILRACKELGIKAVHSSADRDIISAAEITGAVAIH-PGYGFLSENA
3df7A           -SLKLFLFEFATCGERI-----EDSTAVEGLAFKSAFDGFKNYYEPEFSCLFTKSDAFLIIAPEDD-FLL
1dv2A           MLDKIVIANRG---EI------ALRILRACKELGIKAVHSSADRNIPAIISAAEITGAVAIHPGYGSENA
2dzdB           --RKVLVANRGEIAIRVFRACTELGIRTVAIYEGKKPIEAYLDIEGIIEIAKAHDVDAIHPGYGFLSENI
1auvB           --RVLLVIEPHTDWAKYFKGEQAEFSDLNLVAHANGGFSVDEVRNGVKVVRSLKPDFVLIRQHAFSARNG
3bg5D           ------------------------------------------------------------------NEDK
1bncB           MLDKIVIANRGEI---------ALRILRACKELGIKTVAVHSSADRDLKHVLLADETVIHPGYGFLSENA
3d8tA           -------------------------------------------------------------AYAGLRRKE
1dv2B           MLDKIVIANRG---EI------ALRILRACKELGIKTVASYLNIPAIISAAEITGAVAIHPGYGFLSENA
2dzdA           --RKVLVANRGEIAIRVFRACTELGIRTVAIYSKEDVGSYHRYKADEAYLVGEGKKPIEAYLYGFLSENI
2c00A           MLEKVLIANRGEIALRILRARELMHLSLADESVCIGPAPATQSYLQIPAIIAAAEATAIHPGYGFLAENA
1dv1B           MLDKIVIANRGEIALRILRASSADRDLKHVLLADETVCIGPAPSVKSYLNIPATGAVAIHPGYGFLSENA
3d8rA           -------------------------------------------------------------AYAGLRRKE
3bg5C           --KKLLVARGEIAIRSTVAIYSNEDKSSLHRYKADESYLVGSDLRIIDVAKQANVDAIH-PGYGFLSENE
2czgA           SAQKILLLGSGEL---------GKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMIIPEIEAINL
1auvA           --ARVLLVIDE---PHTD----WAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHKPDFVLIRQHAFSARNG
3d8tB           ----------------------------------------------------------MRIAYAGLRRKE
2dxcF           ----------------------------------------------------------------------
1b6sC           --KQVCVLGNGQL---------GRMLRQAGEPLGIA-------VWPVGLDAEPAAVPFQQSVITAEIERW
3d8nA           -------------------------------------------------------------AYAGLRRKE
1b6sA           --KQVCVLGNGQL---------GRMLRQAGEPLGIAVWPVGLDAE-------PAAVPFQQSVITAEIERW
2dwcB           SAQKILLLGSGEL---------GKEIAIEAQRLGVEVVAVDRYANAPAMWSVVEREKPDAIIPEIEAINL
2czgB           SAQKILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVIPEIEAINL
2dwcA           SAQKILLLGSGELGKEIAIEVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINL
2dd4C           ----------------------------------------------------------------------
1b6rA           --KQVCVLGNGQL---------GRMLRQAGEPLGIAVWPVGLDAE-------PAAVPFQQSVITAEIERW
2dd4F           ----------------------------------------------------------------------
1auxA           -------------------------------------------RNGVKVVRSLKPDFVLHAFSMARNGDY
1cqjB           ----------------------------------------------------------------------
2cqyA           ----------------------------------------------------------------------
2bv8B           ----------------------------------------------------------------------
2bjqA           ------------------------------------------------------------------QSTP
3czxA           --------VNGSDREADLAQDRNIVASILRNDYGLTVKTDGTGKGNPDAVKLIRGSDVAIEFHTNAAANK
1dosA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YIQAILETKKIPYTHSGVIASSIAMDKEISKKIFIKNKILTPKYXXXXXXXXXXXXXXXXXXXXXFPVVV
3e5nA           SLQGLLRMANLPFVGSGVLGSAVAMDKDMAKRVLRDARLAVAPFVCFDRHTAAHADVDTLIAQLGLPLFV
1ehiA           TLQGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPESANNWSWDKIVAELGNIVFV
1e4eA           SIQGLFELSGIPFVGCDIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDRPVAATFT------YPVFV
1e4eB           SIQGLFELSGIPFVGCDIQSSAICMDKSLTYIVAKNAGIATPAF------WVINKDDRPVAATFTYPVFV
1a9xA           ERQGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARS----GIAHTMEEALAVAADVGFPCII
1ehiB           TLQGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPESANNWSWDKIVAELGNIVFV
1c30A           KLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPAN----ATVTAIEMAVEKAKEIGYPLVV
1bxrA           ALQGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAADVG----FPCII
1ce8A           ERQGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARS----GIAHTMEEALAVAADVGFPCII
1b6sB           PETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLG----ELAIV
3bg5A           QFARRCAEEGIKFIGPHLEHLDMFGDKVKARTTAIKADLPVIPGTDGPIKSYELAKEFAEEAG--FPLMI
2c00B           DFAEQIERSGFTFVGPTAEVIRLMGDKVSAKDAMKRAGVPTVPGSDGPLPEDEETALAIAREVG-YPVII
1bncA           NFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIG-YPVII
3bg5B           SSLHRYKADESYLVGSDLGPAESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFARRCAEEG--IKFIG
1dv1A           NFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPG-SDGPLGDDMDKNRAIAKRIGYPVII
3df7A           YTLTKKAEKYCENLGSSSRAIAVTSDKWELYKKL-RGEVQVPQTSLRPLD---------------CKFII
1dv2A           NFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIG-YPVII
2dzdB           QFAKRCREEGIIFIGPNENHLDMFGDKVKARHAAVNAGIPVIPGSDGPVDGLEDVVAFAEAHG--YPIII
1auvB           DYRSLVIGLQGIPSINSLHSVYNFCDKPWVFAQVRLHKKLGTEE--FPLINQTFYPNHKELSSTTYPVVV
3bg5D           SSLHRYKADESYLVGSDLGPAESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFARRCAEEG--IKFIG
1bncB           NFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGDDMDKNRAIAKRIG----YPVII
3d8tA           EFKALAEKLGFTPLLFPVQATEKVPVPEYRDQVRELAQGVDLFLATTGVGVRDLLEAGKALGLDLEGPLA
1dv2B           NFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIG-YPVII
2dzdA           QFAKRCREEGIIFIGPNENHLDMFGDKVKARHAAVNAGIPVIPGSDGPVDGLEDVVAFAEAHG--YPIII
2c00A           DFAEQIERSGFTFVGPTAEVIRLMGDKVSAKDAMKRAGVPTVPGSDGPLPEDEETALAIAREVG-YPVII
1dv1B           NFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIG-YPVII
3d8rA           EFKALAEKLGFTPLLFPVQATEKVPVPEYRDQVRELAQGVDLFLATTGVGVRDLLEAGKALGLDLEGPLA
3bg5C           QFARRCAEEGIKFIGPHLEHLDMFGDKVKARTTAIKADLPVIPGTDGPIKSYELAKEFAEEAG--FPLMI
2czgA           DALFEFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEKIG----YPCHT
1auvA           DYRSLVIGYAGIPSINSLHSVYNFCDKPWVFAQVRLHKKLGTEEFPLINQTFYPNHKELSSTT--YPVVV
3d8tB           EFKALAEKLGFTPLLFPVQATEKVPVPEYVRELAQGVDLFLATT---GVGVRDLLEAGKALGLDLEGPLA
2dxcF           ----------------------------------------------------------------------
1b6sC           PETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLG----ELAIV
3d8nA           EFKALAEKLGFTPLLFPVQATEKVPVPEYRDQVRELQGVDLFLA----TTGVGVRDLLEAGKALGLDLEG
1b6sA           PETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLG----ELAIV
2dwcB           DALFEFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEKIG----YPCHT
2czgB           DALFEFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEKIG----YPCHT
2dwcA           DALFEFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEKIG----YPCHT
2dd4C           ----------------------------------------------------------------------
1b6rA           PETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLG----ELAIV
2dd4F           ----------------------------------------------------------------------
1auxA           RSLVIGLQYAGIPSINSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLINQTFYPNHKEMLSSTTYPVVV
1cqjB           -----------------------NLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGA---GPWVV
2cqyA           -------------------SSGSSGDKIESKLLAKKAEVNTIPG--FDGVVKDAEEAVRIAREIGYPVMI
2bv8B           -----------------------------------------------------------------QPQLI
2bjqA           VIMKTKDKDLLGYIDMSTEVAAVGVSGKSGGPIQDMLVLFRNVKAPPKGIKIYDDTWLDLKYRDPFPAAR
3czxA           TA-----TGIEALSTPKNKRWCQVLGKAVAKKTGWKLRGEDGF---------------------------
1dosA           -------------------PGVITGDDVQKVFQVAKENNFALPA-VNCVGTDSINAVLETAAKVKAPVIV


                         +         .         .         .         .         *         .:210
query           KPINEGSSVHVYICDKTNILKNLKVLKSYNEILIEEFIPGREIQVAIMNNKSLGAIELEPRRKFYDYEAK
3e5nA           KPANQGSSVGVSQVRTADAFAAALALAYDHKVLVEAAVAGREIECAVLGNAVPHASVCGEV---------
1ehiA           KAANQGSSVGISRVTNAEEYTEALSFQYDYKVLIEEAVNGARELEVGVIGNDQPLVSEIGAHGWYDYNNK
1e4eA           KPARSGSSFGVKKVNSADELDYASARQYDSKILIEQAVSGCEVGCAVLGNSAALVVGEVDQRIHQEVEPE
1e4eB           KPARSGSSFGVKKVNSADELDYASARQYDSKILIEQAVSGCEVGCAVLGNSAALVVGEVDQRIHQEVEPE
1a9xA           RPSFTMGGSGGGIAYNEEICARGLDLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMGI
1ehiB           KAANQGSSVGISRVTNAEEYTEADSFQYDYKVLIEEAVNGRELEVGVIGNDQPLVSEIGAH---------
1c30A           RPAMEIVYDEADLRRY----------FQTAVLLDHFLDDAVEVDVDAICDG--EMVLIGGIMEHIEQAGV
1bxrA           RPSFTMGGSGGGIAYNEEICARGLDLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMGI
1ce8A           RPSFTMGGSGGGIAYNEEICARGLDLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMGI
1b6sB           KRRTGGYDGRGQWRLRANETEQL-PAECYGECIVEQGINFGEVSLVGARGFDGSTVFYPLT------HNL
3bg5A           KATSRIVREESELEDAFHRAKSEEKSFGNSEVYIERYIDNKHIEVQVIGDEHGNIVHLFER---DCSVQR
2c00B           KAAGGGMRVVYDESELIKSAKLTEAGAGNPMVYLEKFLTNRHVEVQVLSDGQGNAIHLGDR----DCSLQ
1bncA           KRGMRVVRGDAELAQSISMT-----RAEAKMVYMEKYLENRHVEIQVLADGQGNAIYLAE----RDCSMQ
3bg5B           PHLEHLDMFGDKVKA------RTTAIKADLPVIPIDNPKHIEVQVIG-----DEHGNIVHLFERDCSVQR
1dv1A           KASMRVVRGDAELAQSISMTRAEA----NDMVYMEKYLEPRHVEIQVLADGQGNAIYLAER----DCSMQ
3df7A           KPRTACIGFSDEVPDG---------------HIAQEFIEGINLSVSLAVGEDVKCLSV-----NEQIINN
1dv2A           KASGGGGGRGMRVVRGDAELAQSKAAFSNDMVYMEKYLENRHVEIQVLADGQGNAIYLAER----DCSMQ
2dzdB           KAALGGGGRGMRIVRSKSEVKEARAKSEAKEVYVEKLIEPKHIEVQILGDYEGNIVHLYER---DCSVQR
1auvB           KGHAHSGGKVKVDNQHDFQDIASVVALTKTYATTEPFIDAYDVRIQKIGQNYKAYRLEQIASDRYKL---
3bg5D           PHLEHLDMFGDKVKARTTAIKAD--------LPVIPIDNPKHIEVQVIGDEHGNIVHLFER---DCSVQR
1bncB           KRVVRGDAELAQSISMTRAY------------MEKYLENPRHVEIQVLADGQGNAIYLAER---DCSMQR
3d8tA           KAFRLARGAKAARALKEAGLPPHAVGDGTSKSLLPLLPQGGVAALQLYGKPLPLLENLAERGYRVLPLMP
1dv2B           KASGGGGGRGMRVVRGSMTRAEAKAAFSNDMVYMEKYLENRHVEIQVLADGQGNAIYLAER----DCSMQ
2dzdA           KAALGGGGRGMRIVRSKSEVKEAKAAFGSDEVYVEKLIENKHIEVQILGDYEGNIVHLYER---DCSVQR
2c00A           KAAGGRGMRVVYDESELIKSAKLEAGFGNPMVYLEKFLTNRHVEVQVLSDGQGNAIHLGDRDCSLQRRHQ
1dv1B           KMRVVRGDAELAQSIS------------MTRAYMEKYLENRHVEIQVLADGQGNAIYLAE---RDCSMQR
3d8rA           KAFRLARGAKAARALKEAGLPPHAVGDGTSKSLLPLLPQGGVAALQLYGKPLPLLENLAERGYRVLPLMP
3bg5C           KATSGGGGKGMRIVREHRAKSEAEKSFGNSEVYIERYIDNKHIEVQVIGDEHGNIVHLFER---DCSVQR
2czgA           KAIMSYFVKGPEDIPKAWEKIIVEEH-------IDFDVEVTELAVRHFDENGEIVTTFPKPVGHYQIDGD
1auvA           KGHAHSGGKVKVDNQHDFQDIASVVALTKTYATTEPFIDAYDVRIQKIGQ--------------------
3d8tB           KAFRLARGAKAARALKEAGLPPHAVGDGTSKSLLPLLPQGGVAALQLYGKPLPLLENLAERGYRVLPLMP
2dxcF           -------------------------------EILEMAVRELAIEKGLFSAEDHRV--------WKDYVHT
1b6sC           KRRTGGQWRLRANETEQLPAEC------YGECIVEQGINFGEVSLVGARGFDGSTV-FYPLTHNLHQDGI
3d8nA           PRLARGAKA-------ARALKEAGLPPHAVKSLLPLLPQGRGVAALQLYGKPLPLLALAERGYRVLPLMP
1b6sA           KRRTGGGQWRLRANETEQLPAEC-----YGECIVEQGINFGEVSLVGARGFDGSTVFYPLTHNLHQDGIL
2dwcB           KAIMSGSYFVKGPEDIPKAWEE-------EKIIVEEHIDFVEVTELAVRHFDENGETFPKPVGHYQIDGD
2czgB           KAISYFVKGPEDIPKAWKIIVEHIDFDVEVTELAVRHFDENGEIVTTFPK--------------PVGHYQ
2dwcA           KAIMSYFVKGPEDIPKAWEEEKI-----IVEEHIDFDVEVTELAVRHFDENGEIVTTFPKPVGHYQIDGD
2dd4C           -----------------------------RELAIEKGLFSAEDHRVW-----------------KDYVHT
1b6rA           KRRTGQWRLRANETEQLPAECYGEC------IVEQGINFSGEVSLVGARGFDGSTVFYPL-----THNLH
2dd4F           ------------------------------ELAIEKGLFSAEDHRV-----------------WKDYVHT
1auxA           KMGHAHSGMGKVKVDNQHDFQDIVVALTKTYATTEPFIDAYDVRIQKIGQNYKAYMRTLEQIAMSDRYKL
1cqjB           KCVHAGGNSKEDIRAFLVTYQTDANGQPVNQILVEAATDIKELYLGAVVDRSSRRVVFTEGGVEIEKVAE
2cqyA           KASAGGGGKGMRIADDEETRDGFRLSSQEDRLLIEKFIDNRHISGPSS----------------------
2bv8B           QPGGAYTNRRMAACDMEIVLRYVSYAEIAGSVLDDRCLNGRETYQALGTPGSSVAVKMKEASVSDANDSS
2bjqA           NPIAAGGRKVKSDDGTEALWYEHGQPVFGRAYPKTLANFGWGGQENAGAEIGSFQMLVVPDPDILGFEYK
3czxA           ----------------------------------------------------------------------
1dosA           QFSNIAGKGVKSDVPQGAAILGAISGAHHPVILHTDHCAKKLLPWIDGLLDAGEKH------FAATGKPL


                         .         .         .         +         .         .         .:280
query           YNSSAKTKHLIPVDLSKNNLAKITGIARAAHKIIGCKGVTRSDFKFFNGKFYLLEINTQPGMTKLSLVPE
3e5nA           -----VVEIVIPADIDAQTQQRIQQIAVQAYQALGCAGMARVDVFLCDGRIVINEVNTLPGFTRISVYPK
1ehiA           FVDNSAVHFQIPAQLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLDNNVPYLGEPNTLPGFTNMSLFKR
1e4eA           KGS-ENAVITVPADLSAEERGRIQETVKKIYKTLGCRGLARVDMFLQNGRIVLNEVNTLPGFTSYSRYPR
1e4eB           KGSEN-AVITVPADLSAEERGRIQETVKKIYKTLGCRGLARVDMFLQRGRIVLNEVNTLPGFTSYSRYPR
1a9xA           HT-GDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGGSNVQFAVNGRLIVIEMNPRVSRS-------
1ehiB           -----TVHFQIPAQLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLENNVPYLGEPNTLPGFTNMSLFKR
1c30A           HSGD-SACSLPAYTLSQEIQDVMRQQVQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAART----VPF
1bxrA           HT-GDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGGSNVQFAVNGRLIVIEMNPRVSRS-------
1ce8A           HT-GDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGGSNVQFAVNGRLIVIEMNPRVSRS-------
1b6sB           HQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNG
3bg5A           RHQ-KVVEVAPSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVE-------
2c00B           RRHQKVIEEAPAPGIDEKARQEVFARCVQACIEIGYRGAGTFEFLYENGRFYFIEMNTRVQVE-------
1bncA           RRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVTEMI
3bg5B           RHQK-VVEVAPSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVE-------
1dv1A           RRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVE-------
3df7A           FRYA--GAVVPARISDEVKREVVEEAVRAVECVEGLNGYVGVDI-VYSDQPYVIEINARLTTP----VVA
1dv2A           RRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIKMNTRIQVE-------
2dzdB           RHQ-KVVEVAPSVSLSDELRQRICEAAVQLMRSVGYVNAGTVEFLVSGDEFYFIEVNPRIQVEHTITEM-
1auvB           -------------------------WVDTCSEIFGGLDICAVEALHGDGRDHIIEVVGSSPLIGDHQDED
3bg5D           RHQKVVE-VAPSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVE-------
1bncB           RHQK-VVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVTEMI
3d8tA           Y---------RHLPDPEGILRLEEAVLRGEVDALAFVAAIQVEF-LFEKDPKALREALNTRVKALAVGRV
1dv2B           RRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIKMNTRIQVE-------
2dzdA           RHQKVVE-VAPSVSLSDELRQRICEAAVQLMRSVGYVNAGTVEFLVSGDEFYFIEVNPRIQVE-------
2c00A           KVIE----EAPAPGIDEKARQEVFARCVQACIEIGYRGAGTFEFLYENGRFYFIEMNTRVQVE-------
1dv1B           RHQKVVE-EAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVTEMI
3d8rA           YRH-------LPDPEGILRLE--EAVLRGEVDALAFVAAQVEFLFEGAKDPKALREALNTRVKALAVGRV
3bg5C           RHQKVVEVA-PSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVE----HTI
2czgA           YHASW-----QPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDT--GMVTL
1auvA           -------NYKAYRTLEQIASDRYKLWVDTCSEIFGGLDICAVEALHGDGRDHIIEVVGSSPLIGDHQDED
3d8tB           YRH-------LPDPEGILRLEEA--VLRGEVDALAFVAAIQVEF-LFEKDPKALREALNTRVKALAVGRV
2dxcF           LGPLPAARLVAKAWLDPEYKKLCIEDGVEASKAVGVNWVTSPPTQFGYCNLRVLADSPTLKHVVVCTLSY
1b6sC           LRT-----SVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNG
3d8nA           YR---------HLPDPEGILRLEEAVLRGEVDALAFVAAIQVEFLFGAKDPKALREALNTRVKALAVGRV
1b6sA           RT------SVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNG
2dwcB           YHASW-----QPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDT--GMVTL
2czgB           IDGD-YHASWQPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDT--GMVTL
2dwcA           Y-----HASWQPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDT--GMVTL
2dd4C           LGPLPAARLVAKAWLDPEYKKLCIEDGVEASKAVGVNWVTSPPTQFGDYCNLRVLADSPTLCTLCSCYPR
1b6rA           QDGI-LRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQ--
2dd4F           LGPLPAARLVAKAWLDPEYKKLCIEDGVEASKAVGVNWVTSPPTQFGDYCNLRVLADSPTLKHVVSCYPR
1auxA           -------------------------WVDTCSEIFGGLDICAVEALHGDGRDHIIEVVGSS----MPLIGD
1cqjB           ETPH-LIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKIFMGLERDLALIEINPLVITKQGDLICL
2cqyA           ----------------------------------------------------------------------
2bv8B           G---------TPSGDCSSLSAELGTYFDRAAS--------------------------------------
2bjqA           WIPYKEAKAGGPKPLHVGECTPCLLKDANGTERLGNLHMGMEKATAGLAGKDSAVSGPAVG---------
3czxA           ----------------------------------------------------------------------
1dosA           FSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGMDASALYTQPEDVDYA----YTE


                         .         *         .         .         .         .         +:350
query           IAKHKGISFIKLIEWILKDASINR
3e5nA           LWQASGLDYRGLITRLI-------
1ehiA           LWDYSDINNAKLVDMLIDYG----
1e4eA           MMAAAGISLPELIDRLI-------
1e4eB           MMAAAGISLPELIDRLI-------
1a9xA           ------------------------
1ehiB           LWDYSDINNAKLVDMLI-------
1c30A           VSKATGVPLAKVAARVMAGKSL--
1bxrA           ------------------------
1ce8A           ------------------------
1b6sB           ASISQFELHLRAI-----------
3bg5A           ------------------------
2c00B           ------------------------
1bncA           TGVDLIKEQLRIA-----------
3bg5B           ------------------------
1dv1A           ------------------------
3df7A           FSRAYGASVADLLAGGE-------
1dv2A           ------------------------
2dzdB           ------------------------
1auvB           KQ--LIVELVVNK-----------
3bg5D           ------------------------
1bncB           TGVDLIKEQLRIAA----------
3d8tA           TAD---------------------
1dv2B           ------------------------
2dzdA           ------------------------
2c00A           ------------------------
1dv1B           TGVDLIKEQLRIAA----------
3d8rA           TADALREWGVKPF-----------
3bg5C           TEMVTGIDIVKTQILVAAGADLFG
2czgA           ASHPPGFSEFALHLRAVLGLPI--
1auvA           KQ--LIVE---LVVNKAQ------
3d8tB           TAD---------------------
2dxcF           PRPILGQSPE--------------
1b6sC           ASISQFELHLRAI-----------
3d8nA           TADA--------------------
1b6sA           ASISQFELHLRAI-----------
2dwcB           ASHPPGFSEFALHLRA--------
2czgB           ASHPPGFSEFALHLRAVLGLPI--
2dwcA           ASHPPGFSEFALHLRA--------
2dd4C           PILGQSPEWYRSPNYRRRLVRWPR
1b6rA           ------------------------
2dd4F           PILGQSPEWYRSPNYRRRLVRWPR
1auxA           HQDEDKQLIVELVVNKMAQA----
1cqjB           DGKL--------------------
2cqyA           ------------------------
2bv8B           ------------------------
2bjqA           ------------------------
3czxA           ------------------------
1dosA           LSKISPRFTIAASFGN--------