[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ20908.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bggA.bssp"
#ERROR : Can't open dsspfile "3c65A.bssp"
#ERROR : Can't open dsspfile "2csdA.bssp"
#ERROR : Can't open dsspfile "2csbA.bssp"
#ERROR : Can't open dsspfile "1dgsA.bssp"
#ERROR : Can't open dsspfile "1bgxT.bssp"
#ERROR : Can't open dsspfile "2bhnC.bssp"
#ERROR : Can't open dsspfile "1dgtB.bssp"
#ERROR : Can't open dsspfile "1cmwA.bssp"
#ERROR : Can't open dsspfile "2bhnA.bssp"
#ERROR : Can't open dsspfile "2bgwA.bssp"
#ERROR : Can't open dsspfile "2bgwB.bssp"
#ERROR : Can't open dsspfile "2bhnB.bssp"
#ERROR : Can't open dsspfile "1cukA.bssp"
#ERROR : Can't open dsspfile "1bvsA.bssp"
#ERROR : Can't open dsspfile "3c1yA.bssp"
#ERROR : Can't open dsspfile "1bvsB.bssp"
#ERROR : Can't open dsspfile "1c7yA.bssp"
#ERROR : Can't open dsspfile "1d8lA.bssp"
#ERROR : Can't open dsspfile "2a1jB.bssp"
#ERROR : Can't open dsspfile "1bqqT.bssp"
#ERROR : Can't open dsspfile "3bz1U.bssp"
#ERROR : Can't open dsspfile "3c5nA.bssp"
#ERROR : Can't open dsspfile "2a1jA.bssp"
#ERROR : Can't open dsspfile "2duyA.bssp"
#ERROR : Can't open dsspfile "1b22A.bssp"
#ERROR : Can't open dsspfile "1e52A.bssp"
#ERROR : Can't open dsspfile "2bskA.bssp"
#ERROR : Can't open dsspfile "3egaA.bssp"
#ERROR : Can't open dsspfile "2eduA.bssp"
#ERROR : Can't open dsspfile "2axtU.bssp"

## Summary of PDB Search
:611
    1e-48   9%  2bggA  [x.x.x] PROTEIN AF1318
    8e-40  34%  3c65A  [x.x.x] UVRABC SYSTEM PROTEIN C
    9e-37  14%  2csdA  [x.x.x] TOPOISOMERASE V
    7e-31  12%  2csbA  [x.x.x] TOPOISOMERASE V
    5e-28  10%  1dgsA  [d.142.2 - b.40.4 - a.60.2] DNA LIGASE
    2e-25  12%  1bgxT  [c.120.1 - a.60.7 - c.55.3 - e.8.1] TAQ DNA POLYMERASE
    3e-25  16%  2bhnC  [x.x.x] XPF ENDONUCLEASE
    1e-24  12%  1dgtB  [x.x.x] DNA LIGASE
    3e-24  12%  1cmwA  [c.120.1 - a.60.7 - c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE
    2e-22  17%  2bhnA  [x.x.x] XPF ENDONUCLEASE
    2e-21  19%  2bgwA  [x.x.x] XPF ENDONUCLEASE
    2e-21  19%  2bgwB  [x.x.x] XPF ENDONUCLEASE
    2e-21  17%  2bhnB  [x.x.x] XPF ENDONUCLEASE
    9e-19  14%  1cukA  [x.x.x] RUVA PROTEIN
    5e-17  16%  1bvsA  [b.40.4 - a.60.2 - a.5.1] PROTEIN (HOLLIDAY JUNCTION DNA
    7e-17  15%  3c1yA  [x.x.x] DNA INTEGRITY SCANNING PROTEIN DISA
    2e-15  14%  1bvsB  [b.40.4 - a.60.2 - a.5.1] PROTEIN (HOLLIDAY JUNCTION DNA
    3e-15  14%  1c7yA  [b.40.4 - a.60.2 - a.5.1] HOLLIDAY JUNCTION DNA HELICASE RUVA
    7e-15  14%  1d8lA  [b.40.4 - a.60.2] PROTEIN (HOLLIDAY JUNCTION DNA HELICASE
    7e-13  17%  2a1jB  [x.x.x] DNA EXCISION REPAIR PROTEIN ERCC-1
    4e-12  11%  1bqqT  [b.40.3] METALLOPROTEINASE INHIBITOR 2
    8e-10   7%  3bz1U  [x.x.x] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN
    1e-09  24%  3c5nA  [x.x.x] TUBBY-RELATED PROTEIN 1
    1e-09  27%  2a1jA  [x.x.x] DNA REPAIR ENDONUCLEASE XPF
    4e-07  17%  2duyA  [x.x.x] COMPETENCE PROTEIN COMEA-RELATED PROTEIN
    2e-06  22%  1b22A  [a.60.4] DNA REPAIR PROTEIN RAD51
    3e-06  26%  1e52A  [a.2.9] EXCINUCLEASE ABC SUBUNIT
    2e-05  15%  2bskA  [x.x.x] MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE
    4e-05  12%  3egaA  [x.x.x] PROTEIN PELLINO HOMOLOG 2
    1e-04  13%  2eduA  [x.x.x] KINESIN-LIKE PROTEIN KIF22
    1e-04  11%  2axtU  [x.x.x] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN
:611

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQTFKL
2bggA           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
1bvsB           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
1bqqT           -----------------------------------IVIRAKAVNKKEVDSGND--IYGNPIKRIQYEIK-
3bz1U           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
1e52A           ----------------------------------------------------------------------
2bskA           ----------------------------------------------------------------------
3egaA           ----------------------GVWREISVCGDVYTLRETRSAQQRGKVESETNLQDGSLIDLCGATLLW
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EIXXXXXXXXXXXXXXXXIKKHKPKFNILLKDDKSFPFVFISNKDQWAQVTKHRGKKDKEGFYFGPFASA
2bggA           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
1bvsB           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
1bqqT           QIKMFKGPDQDIEFIYTAPAAAVCGVSLDIGGKKEY--LIAGKAEGNGNMHITLCD------FIVPWDTL
3bz1U           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
1e52A           ----------------------------------------------------------------------
2bskA           ----------------------------------------------------------------------
3egaA           R---------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GTANWTIKMLQKIFQIRVCDDSTFKNRKRPCILYQIKRCSGPCVDYIDKEDYKKSVDQAIQFVSGKSRDI
2bggA           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
1bvsB           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
1bqqT           SAT--QKKSLNHRYQ-MGCECKITRCPMIPCYISSPDEC-------------------------------
3bz1U           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
1e52A           ------------------------------------------------------EPDNVPMDMSPKALQQ
2bskA           ----------------ETCFLDCVKDFTTREVKPEETTCSEHCLQYLK----------MTQRISMRFQEY
3egaA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QKNLSKQMEEASEKLDFERASIFRDRIKSLNIIQSSQRINEANLIDADVIAAYKESGKTCIQVFFYRSKQ
2bggA           --------------RIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALINQLKSQISSKIDEVWHI
3c65A           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
1bvsB           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
1e52A           KIHLEGLMMQHAQNLEFEEAAQIRDQLHQL----------------------------------------
2bskA           HIQQNEALAAKAGLL-------------------------------------------------------
3egaA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NWGNQAYFPKHDPDQSLSEIMSSFLMQFYENKNVPKLIIINTEIEDKKLIEETLSKKENSAISINVAKKG
2bggA           HNINISEFIY---DSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTP---LYYKLKSYLINSIPSQFMRDI
3c65A           ----------------------------------------------------------------------
2csdA           ---------------------------------------------------------------IVEHKRD
2csbA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
1bvsB           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
1e52A           ----------------------------------------------------------------------
2bskA           ----------------------------------------------------------------------
3egaA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TKAKVIAMAEKNAKESLNRKIYETNNNKNLFEGVAKKFDLKNGLNLVEVYDNSHISGTNSVGAMITFGNE
2bggA           LSNRNLTFYVDNLLVQFVSKLGGKPWILNV--------DPEKGSDIIIGTGATRIDNVNLFCFAMVFKKD
3c65A           ----------------------------------GERLGIPA-PRRIEAFDNSNIYGADPVSALVVFLDG
2csdA           IMRRYLEQRIVECALKLQDRY-------GIREDVALCL-ARAFDGSISMIATTPYRTLKVCPDLTLEEAK
2csbA           ---------------------------------------------LARAFDGSISIATTPYRTLKDVCPD
1dgsA           -------------------------------------LGAEGVEEVYRRGLAQRHALPFEADGVV-LKLD
1bgxT           --------------------------------------GLTTSRGEGFAKSLLKALKEDGDAVIVVFKAP
2bhnC           ---------------------------------------------------------------VDVREER
1dgtB           -------------------------------------LGAEGVEEVYRRGLAQRHALPFEADGVVLKLD-
1cmwA           ------------------------------LKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFKAP
2bhnA           -----------------------------------------------------------VYVDVREERSP
2bgwA           ------------------------------------------------------MLEDPGGRPRVYVDVR
2bgwB           ----------------------------------------------------------------------
2bhnB           ------------------------------------------------------------RVYVDVREER
1cukA           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
1bvsB           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
1e52A           ----------------------------------------------------------------------
2bskA           ----------------------------------------------------------------------
3egaA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GFVKKRYRKFDIKTKGNEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFG
2bggA           GTMLWNEISPIVTSS-EYLTYLKSTIKKVVYGFKK------SNPDWDVEKLTLHVSGKRPKMKDGETKIL
3c65A           KPAKKEYRKYKVKTV-AGPNDYE-TREVVRRRYTRVLKEGL---PLPDLIIIDGGKGHLSAVRDVLENEL
2csdA           SVNRTLATLIDEH--GLSPDAADELIEHFESIA---------GILATDLEEIERMYEEGRLSEEAYRAAV
2csbA           LTLEEAKSVNRTLAT---LIDEHGLSPDAADELIEHFESIAG-ILATDLEEIERYEEGRLSEEAYRAAVE
1dgsA           DLTLWGELGYTARAPAYKFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSRVTLHNESYIEELDI
1bgxT           SFRHEAYGGYKAGRA-PTPEDFPRQLALIKELVDL--------LGLARLEVPGYEADDVLASLAKKAEKE
2bhnC           SPVPSILESLGVQVIPKQLDYLVSDSIIVERKT------------SSDFAKSLFDGRLFEQASRLAEHYE
1dgtB           DLTLWGELGYTARAPALAYKFPAEEKETRLLDVVFQVGRTGRVVGVLEPVFIEGSRVTLHNESYIEEDIR
1cmwA           SFRHEAYGGYKAGRA-PTPEDFPRQLALIKELVDLLGL--------ARLEVPGYEADDVLASLAKKAEKE
2bhnA           --VPSILESLGVQVIP---KQLPMGDYLVSDSIIVERKTSSD---FAKSLFDGRLFEQASRLAEHYETVF
2bgwA           EEVPSILESLGVQVIPK---QLPMGDYLVSDSIIVE------RKTSSDFALFDGRLFEQASRLAEHYETV
2bgwB           --VPSILESLGVQVIP---KQLPMGDYLVSDSIIVERKTSSD---FAKSLFDGRLFEQASRLAEHYETVF
2bhnB           SPVPSILESLGVQV---IPKQLPMGDYLVSDSIIVERKT----SSDFAKSLFDGRLFEQASRLAEHYETV
1cukA           --------------------------------------------------MIGRLRGIIIEKQPPLVLIE
1bvsA           --------------------------------------------------MIFSVRGEVL---EVALDHA
3c1yA           ----------------------------------------------------------------------
1bvsB           --------------------------------------------------MIFSVRGEVLEVALDHAVIE
1c7yA           --------------------------------------------------MIGRLRGIIIEKQPPLVLIE
1d8lA           --------------------------------------------------MIGRLRGIIIEKQPPLVLIE
2a1jB           ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
1e52A           ----------------------------------------------------------------------
2bskA           ----------------------------------------------------------------------
3egaA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LHDLPMIAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAITSHRAKRAKGITKSLLD
2bggA           KETVEELKKQEMVSRDVKYAILHLNETHPFWMEGTKVKLSSKRYLLTLLQPYVTPIKPLSVEIVSDNWTS
3c65A           GLDVPLAGLSELLAGDPPDV--------VPLDRQSQEFYLLQRIQDEVHRFAV-----------------
2csdA           EIQLAELTKKEGVGRKTAERLLR----AFGNPERVKQLAREFEIEKLASVEGVGERVL-RSLVPGYASLI
2csbA           IQLAELTKKEGVGRKTAERLLRAFGNERVKQLAREFEIEKLASVEGVGERVLRSLV-------PGYASLI
1dgsA           RIGDWVLHKAGGVIPEVLRVLKERRERPIRWPEACPECGHRLVKEGKVHRCPNPLCPAKRFEAIASRKAM
1bgxT           GYEVRILTADKDLYQLLSDRIHVLH--------PEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLP
2bhnC           TVFII-VEGPPVPRRYRGRERSLYAAMAALQLDYGIRLMNTMDPKGTALVIESLARLSSDVREWQLYILQ
1dgtB           IGDWVLVHKAGGVIPEVLRVLKERRERPIRWPEACPECGHRLVKEGKVHRCPNPLCPAKRFEAIASRKAM
1cmwA           GYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAW-LWEKYGLRPDQWADYRALTGD-------ESDNLP
2bhnA           IIVEPVPRRYRGRERSLYALDYGIRLMNTMDPKGTLVIESLARLSTREGGQRIVIHKKPRLSDVREWILQ
2bgwA           FIIVPVPRRYRGRERSLYALDYGIRLMNTMDPKTALVIESLARLSTREGGQRIVIHKKPRLSDVREWILQ
2bgwB           II----VEGPPVPRRYRGRERSLYA--AMAALQLDYGIRLMNTMDPKGTALVIESLARLSTKPRLSDILQ
2bhnB           FIIVEGPPVPR---RYRGRERSLYAAMAALQDYGIRLMNTMDPKGTALSLARLSTRRLSDVREWQLYILQ
1cukA           VGGVGYEVHMPMTCF-----------YELPEAGQEAIVFTHFVVREDAQLLYGFNNKQERTLFK---ELI
1bvsA           VIEAAGI----------GYRVNATPSALATLNQGSQALVTAMVVREDSMTLYGFSDAENRDLFL---ALL
3c1yA           ------------------------EVEEETAQNILQDFITRREPSPISISRVLGYDVQQAAQARGYRLLK
1bvsB           AAG-------IGYRVNATPSALATLNQG-----SQARLVTAMVVREDSMTLYGFSDAENRDL---FLALL
1c7yA           VGGVGYEVHMPMTCF-----------YELPEAGQEAIVFTHFVVREDAQLLYGFNNKQERTLFK---ELI
1d8lA           VGGVGYEVHMPMTCF-----------YELPEAGQEAIVFTHFVVREDAQLLYGFNNKQERTL---FKELI
2a1jB           ---------------------------------------------------LLMEKLEQDFVSRVTECLT
1bqqT           ----------------------------------------------------------------------
3bz1U           -----------------------------------------ELVNVVDEKLGTAYGEKIDLNNTNIAAFI
3c5nA           -----------------------------TRDKMYPS--YFLHLDTEKKVFLLAGRKRKRSKTYLISIDP
2a1jA           -----------------------------------------------------------------QDFLL
2duyA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------EESFGPQPISRL
1e52A           ----------------------------------------------------------------------
2bskA           ----------------------------------------------------------------------
3egaA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------SARDLR
2axtU           -----------------------------------------EELVNVVDEKLGTAYGEKIDLNNNIAAFI


                         .         .         .         *         .         .         .:630
query           QIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKIYNFFHE
2bggA           EEYYHNVHEILDEIYYLSKMNWR-GFRSRNLPVTVNYPKLVAGIIANVNRY
3c65A           ---------------------------------------------------
2csdA           SIRGIDRERAERLLKKYGGYSKVREAGVEELR-EDGLTDAQIRELKGL---
2csbA           SIRGIDRERAERLLKKYGGYSKVREAGVEELR-EDGLTDAQIRELKGL---
1dgsA           DIEGLGEKLIERLLEKVRDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEE
1bgxT           GVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDL
2bhnC           SFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKRAEEIKKILMT
1dgtB           DIEGLGEKLIERLLEKGLDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEE
1cmwA           GVKGIGEKTARKLLEEWGSLEALLKN-LDRLK--PAIREKILAHMDDLKLS
2bhnA           SFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKRAEEIKKILMT
2bgwA           SFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKRAEEIKKILMT
2bgwB           SFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKRAEEIKKILMT
2bhnB           SFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKRAEEIKKILMT
1cukA           KTNGVGPKLALAILSGMSAVNAVEREEVGALVKLPGIGKKTAERLIVEMKD
1bvsA           SVSGVGPRLAMATLAVHDLRQALADSDVASLTRVPGIGRRGAERIVLELAD
3c1yA           TVARIPLSIGYNVVRMFKTLDQISKASVEDLKKVEGIGEKRARAISESISS
1bvsB           SVSGVGPRLAMATLAVHDARQALADSDVASLTRVPGIGRRGAERIVLELAD
1c7yA           KTNGVGPKLALAILSGMSAVNAVEREEVGALVKLPGIGKKTAERLIVEMKD
1d8lA           KTNGVGPKLALAILSGMSAVNAVEREEVGALVKLPGIGKKTAERLIVEMKD
2a1jB           TVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHE
1bqqT           ---------------------------------------------------
3bz1U           QYRGLYPTLAKLIVKNAP------YESVEDVLNIPGLTERQKQILRENLE-
3c5nA           TNNFIGKLRSNLLGNRFTVFDNGQNPQRGYSTNVASLRQELAAVIY-----
2a1jA           KMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGN-AANAKQLYDFIHT
2duyA           ---GIGPVLARRIVEGRPYA------RVEDLLKVKGIGPATLERLRPYLR-
1b22A           EQCGINANDVKKLEEAFHTVEAVAYAPKKELINIKGISEAKADKILAEAAK
1e52A           ---------------------------------------------------
2bskA           ---------------------------------------------------
3egaA           ---------------------------------------------------
2eduA           SLQRIGPKKAQLIVGWRELHGPF--SQVEDLERVEGITGKQMESFLKA---
2axtU           QYRGLYPTLAKLIVKNAPYE------SVEDVLNIPGLTERQKQILRENLE-