[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ20910.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ej0D.bssp"
#ERROR : Can't open dsspfile "2eiyB.bssp"
#ERROR : Can't open dsspfile "2ej0F.bssp"
#ERROR : Can't open dsspfile "2ej0E.bssp"
#ERROR : Can't open dsspfile "2ej2E.bssp"
#ERROR : Can't open dsspfile "1a0gB.bssp"
#ERROR : Can't open dsspfile "2eiyC.bssp"
#ERROR : Can't open dsspfile "1a0gA.bssp"
#ERROR : Can't open dsspfile "1a3gA.bssp"
#ERROR : Can't open dsspfile "1daaA.bssp"
#ERROR : Can't open dsspfile "5daaA.bssp"
#ERROR : Can't open dsspfile "3dtgA.bssp"
#ERROR : Can't open dsspfile "3cswC.bssp"
#ERROR : Can't open dsspfile "3cswA.bssp"
#ERROR : Can't open dsspfile "2abjD.bssp"
#ERROR : Can't open dsspfile "2abjA.bssp"
#ERROR : Can't open dsspfile "2cojA.bssp"
#ERROR : Can't open dsspfile "2cogB.bssp"
#ERROR : Can't open dsspfile "1ekfA.bssp"
#ERROR : Can't open dsspfile "2abjG.bssp"
#ERROR : Can't open dsspfile "2coiA.bssp"
#ERROR : Can't open dsspfile "2coiB.bssp"
#ERROR : Can't open dsspfile "3cebA.bssp"
#ERROR : Can't open dsspfile "2a1hA.bssp"
#ERROR : Can't open dsspfile "2bs71.bssp"
#ERROR : Can't open dsspfile "2dd9A.bssp"
#ERROR : Can't open dsspfile "2dd9C.bssp"
#ERROR : Can't open dsspfile "2dd7A.bssp"
#ERROR : Can't open dsspfile "2dd7B.bssp"
#ERROR : Can't open dsspfile "1ah5A.bssp"
#ERROR : Can't open dsspfile "2dbnA.bssp"
#ERROR : Can't open dsspfile "1d6uB.bssp"

## Summary of PDB Search
:293
    1e-76  39%  2ej0D  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    2e-76  38%  2eiyB  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    4e-74  38%  2ej0F  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    6e-74  39%  2ej0E  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    8e-74  38%  2ej2E  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    2e-72  24%  1a0gB  [e.17.1] D-AMINO ACID AMINOTRANSFERASE
    2e-71  38%  2eiyC  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    5e-71  24%  1a0gA  [e.17.1] D-AMINO ACID AMINOTRANSFERASE
    3e-70  36%  1a3gA  [e.17.1] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    7e-67  25%  1daaA  [e.17.1] D-AMINO ACID AMINOTRANSFERASE
    8e-67  24%  5daaA  [e.17.1] D-AMINO ACID AMINOTRANSFERASE
    4e-65  30%  3dtgA  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    2e-64  26%  3cswC  [x.x.x] PUTATIVE BRANCHED-CHAIN-AMINO-ACID
    1e-63  26%  3cswA  [x.x.x] PUTATIVE BRANCHED-CHAIN-AMINO-ACID
    7e-62  21%  2abjD  [x.x.x] BRANCHED-CHAIN-AMINO-ACID AMINOTRANSFERASE,
    4e-60  23%  2abjA  [x.x.x] BRANCHED-CHAIN-AMINO-ACID AMINOTRANSFERASE,
    8e-60  25%  2cojA  [x.x.x] BRANCHED CHAIN AMINOTRANSFERASE 1, CYTOSOLIC
    3e-59  26%  2cogB  [x.x.x] BRANCHED CHAIN AMINOTRANSFERASE 1, CYTOSOLIC
    9e-59  22%  1ekfA  [e.17.1] BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE
    4e-56  23%  2abjG  [x.x.x] BRANCHED-CHAIN-AMINO-ACID AMINOTRANSFERASE,
    3e-55  26%  2coiA  [x.x.x] BRANCHED CHAIN AMINOTRANSFERASE 1, CYTOSOLIC
    6e-49  25%  2coiB  [x.x.x] BRANCHED CHAIN AMINOTRANSFERASE 1, CYTOSOLIC
    7e-37  15%  3cebA  [x.x.x] D-AMINOACID AMINOTRANSFERASE-LIKE PLP-DEPENDENT
    2e-36  19%  2a1hA  [x.x.x] BRANCHED CHAIN AMINOTRANSFERASE
    1e-31  10%  2bs71  [x.x.x] F17BG LECTIN
    4e-30  15%  2dd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    1e-29  15%  2dd9C  [x.x.x] GREEN FLUORESCENT PROTEIN
    5e-29  16%  2dd7A  [x.x.x] GREEN FLUORESCENT PROTEIN
    2e-28  17%  2dd7B  [x.x.x] GREEN FLUORESCENT PROTEIN
    3e-27  11%  1ah5A  [x.x.x] HYDROXYMETHYLBILANE SYNTHASE
    2e-25  11%  2dbnA  [x.x.x] HYPOTHETICAL PROTEIN YBIU
    2e-24  17%  1d6uB  [d.82.1 - d.17.2 - d.17.2 - b.30.2] COPPER AMINE OXIDASE
:293

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIPYDKRSGKIWFNGELVDWADAKIHVLNHGLHYASCVFEGERVYDNSIFKLEEHTSRLFYSAKRMGIKI
2ej0D           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
2eiyB           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
2ej0F           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
2ej0E           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
2ej2E           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
1a0gB           --------GYTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITI
2eiyC           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
1a0gA           --------GYTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITI
1a3gA           ------KADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHVFRHREHMQRLHDSAKIYRFPV
1daaA           --------GYTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITI
5daaA           --------GYTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITI
3dtgA           SIDYTV--DEGWHNAQVIPYGPIQLDPSAIVLHYGQEIFEGLKAYDGSIVSFRPEAARLQSSARRLA--I
3cswC           ---------LIWWRGKFRRADEISLDFSLFEKSLQGAVYETLRTYSRAPFAAYKHYTRLKRSADFFNLPL
3cswA           ----------IWWRGKFRRADEISLDFSLFEKSLQGAVYETLRTYSRAPFAAYKHYTRLKRSADFFNLPL
2abjD           MLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGRLFQPNLNMDRMYRSAVRATLPV
2abjA           MLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVLFQPNLNMDRMYRSAVRATLPV
2cojA           MLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGRLFQPNLNMDRMYRSAVRATLPV
2cogB           MLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVLFQPNLNMDRMYRSAVRATLPV
1ekfA           -----EWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKLFRPWLNMDRMLRSAMRLCLPS
2abjG           MLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVLFQPNLNMDRMYRSAVRATLPV
2coiA           MLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVLFQPNLNMDRMYRSAVRATLPV
2coiB           MLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGRLFQPNLNMDRMYRSAVRATLPV
3cebA           ---------------------------------WQFPLFETILIEQGQAKNISYHQQRYEKSLLKFYPKK
2a1hA           -----EWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKLFRPWLNMDRMLRSAMRLCLPS
2bs71           ---------------------FIGSTE--NDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRIGG
2dd9A           ----------------------------------------------------------------------
2dd9C           ----------------------------------------------------------------------
2dd7A           ----------------------------------------------------------------------
2dd7B           ----------------------------------------------------------------------
1ah5A           ----------------------------------------------------------------------
2dbnA           ---YDPWHAAHRTEVEEYTVDKCSVFRTFQGWTALSDMLPGQHVVPIPYVLLRPLLDDVPEDELCGVAPG
1d6uB           VAPAVKPMQIIEPEGKNYTITGDMIHWRNWDFHLSMNSRVGPMISTV-TYNDNGTKRKVMYEGSLGGMIV


                         .         .         *         .         .         .         .:140
query           PYTEEEINLASKKIISVQGVKDGYVRPTIWRGSEMMAISAQQTKIHVAIATWEWGSYFDPKLKIEGIKLN
2ej0D           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNLPNNPAEVMVAAWEWGAYLVRK----GARLI
2eiyB           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNLPNNPAEVMVAAWEWGAYLGEEAVRKGARLI
2ej0F           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPEVMVAAWEWEEAVR-----KGARLI
2ej0E           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNLPNNPAEVMVAAWEWG-----------ARLI
2ej2E           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNLPNNPAEVMVAAWEWAVR-------KGARLI
1a0gB           PYTKDKFHQLLHELVEKNELNTGHIYFQVTRGTSPRAHQFPENTVKPVIIGYTKENPRPLENLEKGVKAT
2eiyC           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNLPNNPAEVMVAAWEWK----------GARLI
1a0gA           PYTKDKFHQLLHELVEKNELNTGHIYFQVTRGTSPRAHQFPENTVKPVIIGYTKENPRPLENLEKGVKAT
1a3gA           SQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPAGYSTDVIIAAFPWQ----------GIDAM
1daaA           PYTKDKFHQLLHELVEKNELNTGHIYFQVTRGTSPRAHQFPENTVKPVIIGYTKENPRPLENLEKGVKAT
5daaA           PYTKDKFHQLLHELVEKNELNTGHIYFQVTRGTSPRAHQFPENTVKPVIIGYTKENPRPLENLEKGVKAT
3dtgA           PELPEEVFISLRQLIAVGGEESLYLRPFVIATEPGLGVRPSNEYRYLLIA-SPAGAYFKGGIK--PVSVW
3cswC           SLSFDEFTKVLKAGADEFK-QEVRIKVYLFPDSGE---------VLFVFSPLNIPDLE------TGVEVK
3cswA           SLSFDEFTKVLKAGAD-EFKQEVRIKVYLFPDSGEV---------LFVFSPLNIPDLE------TGVEVK
2abjD           F-DKEELLECIQQLVKLSTSASLYIRPAFIGTEPSLGVKKPTKALLFVLL-SPVGPFN-------PVSLW
2abjA           FDKEELLECLDQEWVPYSTSASLYIRPAFIGTEPSLGVKK-PTKALLFVLLSPVGPYF-SSGTFNPVSLW
2cojA           FDKEELLECLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTKALLFVLL-SPVGPYFF-----NPVSLW
2cogB           FDKEELLECLDQEWVPYSTSASLYIRPTFIGTEPSLGVKK-PTKALLFVLLSPVGPYFF-----NPVSLW
1ekfA           FDKLELLECVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRRAL-LFVILCPVGAYFPGGSVTPVSLLA
2abjG           FDKEELLECLDQEWVPYSTSASLYIRPAFIGTEPSLGVKK-PTKALLFVLLSPVGPF-------NPVSLW
2coiA           FDKEELLECLDQEWVPYSTSASLYIRPTFIGTEPSLGVKK-PTKALLFVLLSPVGPYF------NPVSLW
2coiB           FDKEELLECLDQEWVPYSTSASLYIRPTFIGTEPSLGVKK-PTKALLFVLLSPVGPYF------NPVSLW
3cebA           L-QPFDLAKIIAKHTALFTHREGLIRCRIDYNHHDYVLQCFPYQQKVYRTFKPVFCD-------------
2a1hA           FDKLELLECVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRRAL-LFVILCPVGAYFPGGSVTPVSLLA
2bs71           GFCVGLDGKVDLPVVGSLDGQSIYVGLLIWMGDTSRGTAMSGNSWENVFSGWSVGNYLSTQGLSVHVRPV
2dd9A           -----------------------AFSPFLLMFYHFASFPKGTKNIYLHAATNGGYTNTRKEIYEDGGILE
2dd9C           -----------------------AFSPFLLMFYHFASFPKGTKNIYLHAATNGGYTNTRKEIYEDGGILE
2dd7A           -----------------------AFSPFLLSHCMFYASFPKGTKNIYLHAATNGGYTNRKEIYEDGGILE
2dd7B           -----------------------AFSPFLLSHCMFYASFPKGTKNIYLHAATNGGTNTRKEIYEDGGILE
1ah5A           -HPGLVVELVPVTRGDK-GLFVKELEVALLENRADIAVHSKDCEREDPRDAFVSNNYDSLDALPAGSIVG
2dbnA           RVLPVSEQWALTSIPKLEAGDSVWWHCDVIHSVAPVE-NQQGWGNVMYIPAAPMCEKNLAYAHKVKAALE
1d6uB           PYGDPDIGWYFKAYLDSGDYGMGTLTSPIARGKDAPSNA---VLLNETIADYTGVPM-------------


                         +         .         .         .         .         *         .:210
query           ISNWRRPAPNTIPWDTKASGLYMICTLSKHEAEQQGYTDSLMLDHEGNVAEATGANIFFKDKNGEIHTPI
2ej0D           TSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFV-RDGVIYALE
2eiyB           TSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFV-RDGVIYALE
2ej0F           TSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFV-RDGVIYALE
2ej0E           TSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFV-RDGVIYALE
2ej2E           TSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFV-RDGVIYALE
1a0gB           FVEDIRWLRCDIK-----SLNLLGAVLAKQEAHEKGCYEAILHRN-NTVTEGSSSNVFGI-KDGILYTHP
2eiyC           TSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFV-RDGVIYALE
1a0gA           FVEDIRWLRCDIK-----SLNLLGAVLAKQEAHEKGCYEAILHRN-NTVTEGSSSNVFGI-KDGILYTHA
1a3gA           VSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEV-KDGVLFTPP
1daaA           FVEDIRWLRCDIK-----SLNLLGAVLAKQEAHEKGCYEAILHRN-NTVTEGSSSNVFGI-KDGILYTHP
5daaA           FVEDIRWLRCDIK-----SLNLLGAVLAKQEAHEKGCYEAILHRN-NTVTKGSSSNVFGI-KDGILYTHP
3dtgA           LSHEYVRASPGGTGAAKFGGNYAASLLAQAQAAEMGCDQVVWLDERRYVEEMGGMNLFFSGGSARLVTPL
3cswC           ISNVRRIPDLSTPPALKITGRTDIV---LARREIVDCYDVILLGLNGQVCEGSFSNVFLV-KEGKLITPS
3cswA           ISNVRRIPDLSTPPALKITGRTDIVLA---RREIVDCYDVILLGLNGQVCEGSFSNVFLV-KEGKLITPS
2abjD           ANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEDVDNGCQQVLWLYGDHQITEVGTMNLFLEDGEEELATPP
2abjA           ANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEDVDNGCQQVLWLYGRHQITEVGTMNLFLEDGEEELATPL
2cojA           ANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYEDHQITEVGTMNLFLEDGEEELATPL
2cogB           ANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYEDHQITEVGTMNLFLEDGEEELATPP
1ekfA           DPAFIRAWVGGVG-NYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPHQLTEVGTMNIFVYWTHLELVTPP
2abjG           ANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEDVDNGCQQVLWLYGDHQITEVGTMNLFLEDGEEELATPP
2coiA           ANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYEDHQITEVGTMNLFLEDGEEELATPL
2coiB           ANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYEDHQITEVGTMNLFLYWINEELATPL
3cebA           ----------------HIDYSLFSDRTLLNNLLKQKEECDEIIIRQGKVTDCSIGNLIFR-QNNQWITP-
2a1hA           DPAFIRAWVGGVG-NYKLGGNYGPTVLVQQEALKRGCEQVLWLYPDHQLTEVGTMNIFVEDGVLELVTPL
2bs71           INSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLN--------------------------
2dd9A           VNFRYTYEFNKIIGDVECIGPSQSPIFKDTIVKSCPTVDLMLPMS-GNIIASSYARAFQL-KDGSFYTAE
2dd9C           VNFRYTYEFNKIIGDVECIGPSQSPIFKDTIVKSCPTVDLMLPMS-GNIIASSYARAFQL-KDGSFYTAE
2dd7A           VNFRYTYEFNKIIGDVECIGPSQSPIFKDTIVKSCPTVDLMLPMS-GNIIASSYARAFQL-KDGSFYTAE
2dd7B           VNFRYTYEFNKIIGDVECIGPSQSPIFKDTIVKSCPTVDLMLPMS-GNIIASSYARAFQL-KDGSFYTAE
1ah5A           TSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRIRAA-LPPEISLAV
2dbnA           KGASPGDFPR-EDYETNWEGRFTLADLNIHGKRALGM---------------------------------
1d6uB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PDSFLDGITRRTVIEIAKSKGIKVNERKIAPAELSNFVGCFLTGTAAEVTPVSCIAENKFKVCETIIDLN
2ej0D           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPITAGPVALRLR
2eiyB           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPITAGPVALRLR
2ej0F           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPITAGPVALRLR
2ej0E           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPITAGPVALRLR
2ej2E           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPITAGPVALRLR
1a0gB           ANMIAKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVTSTTSEITPVIEIDGKLIKVGEWTRKLQ
2eiyC           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPITAGPVALRLR
1a0gA           NNMIAKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVTSTTSEITPVIEIDGKLIKVGEWTRKLQ
1a3gA           FTSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVRCGPVTKRIQ
1daaA           ANMILKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVTSTTSEITPVIEIDGKLIKVGEWTRKLQ
5daaA           ANMILKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVTSTTSEITPVIEIDGKLIKVGEWTRKLQ
3dtgA           SGSLLPGITRDSLLQLATDAGFAVEERKIDVDEWQKKAGVFACGTAAVITPVSHV---------------
3cswC           LDGILDGITRENVIKLAKSLEIPVEERVVWVWELFEA-DEFLTHTSAGVVPVRRLNEHSFEPGPVTATLE
3cswA           LDGILDGITRENVIKLAKSLEIPVEERVVWVWELFEA-DEFLTHTSAGVVPVRRLNEHSFEPGPVTATLE
2abjD           LDIILPGVTRRCILDLAHQWEFKVSERYLTMDDLNRVREMFSSGTACVVCPVSDIKGETIHIPKLASRIL
2abjA           DGIILPGVTRRCILDLAHQWEFKVSERYLTMDDLTTVREMFSSGTACVVCPVSDILYKGE---TIHIPTM
2cojA           DGIILPGVTRRCILDLAHQWGFKVSERYLTMDDLTTVREMFGSGTACVVCPVSDI---------------
2cogB           LDIILPGVTRRCILDLAHQWGFKVSERYLTMDDLTTVREMFGSGTACVVCPVSDI---------------
1ekfA           LNVILPGVVRQSLLDMAQTWGFRVVERTITMKQLGRVREVFGSGTACQVCPVHRILYKDRNLHELILRFQ
2abjG           LDIILPGVTRRCILDLAHQWEFKVSERYLTMDDLTTVREMFSSGTACVVCPVSDILYKGETI--------
2coiA           DGIILPGVTRRCILDLAHQWGFKVSERYLTMDDLTTVREMFGSGTACVVCPVSDI---------------
2coiB           DGIILPGVTRRCILDLAHQWGFKVSERYLTMDDLTTVREMFGSGTACVVCPVSDILYKGETIH---IPTM
3cebA           DKPLLEGTQRAKLLEQK-----KIIAREIFFEDLAQYEEIRLINANG-----------------------
2a1hA           NGVILPGVVRQSLLDMAQTWGEFRVVER-------TITMKQLLRALEEGRVREVFGSGTACQPVHRIL--
2bs71           ----------------------------------------------------------------------
2dd9A           VKNNPMFTHRRVEETHTKENLAMVEYQQVFNSAP------------------------------------
2dd9C           VKNNPMFTHRRVEETHTKENLAMVEYQQVFNSAP------------------------------------
2dd7A           VKNNPMFTHRRVEETHTKENLAMVEYQQVFNSAP------------------------------------
2dd7B           VKNNPMFTHRRVEETHTKENLAMVEYQQVF----------------------------------------
1ah5A           GQGAVGIECRLDDSRTRELLAALTAERANTRLEGGCQVEIWLRALVGAPDGS------------------
2dbnA           ----------------------------------------------------------------------
1d6uB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ESYQALVRKRKAA
2ej0D           EVYLEAVTGRRP-
2eiyB           EVYLEAVTGRRP-
2ej0F           EVYLEAVTGRRPE
2ej0E           EVYLEAVTGRRP-
2ej2E           EVYLEAVTGRRP-
1a0gB           KQFETKIPKP---
2eiyC           EVYLEAVTGRRPE
1a0gA           KQFETKIPKP---
1a3gA           QAFFGLFTGETE-
1daaA           KQFETKI------
5daaA           KQFETKI------
3dtgA           -------------
3cswC           NFEPFVLNLEE--
3cswA           NFEPFVLNLEE--
2abjD           SKLTDIQYGREES
2abjA           ENGPKLASR----
2cojA           -------------
2cogB           -------------
1ekfA           KELKEIQYGI---
2abjG           -------------
2coiA           -------------
2coiB           ENGPKLASR----
3cebA           -------------
2a1hA           -------------
2bs71           -------------
2dd9A           -------------
2dd9C           -------------
2dd7A           -------------
2dd7B           -------------
1ah5A           -------------
2dbnA           -------------
1d6uB           -------------