[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21022.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bgxT.bssp"
#ERROR : Can't open dsspfile "1cmwA.bssp"
#ERROR : Can't open dsspfile "2bdpA.bssp"
#ERROR : Can't open dsspfile "1bdp-.bssp"
#ERROR : Can't open dsspfile "1d9dA.bssp"
#ERROR : Can't open dsspfile "1d8yA.bssp"
#ERROR : Can't open dsspfile "2ajqA.bssp"
#ERROR : Can't open dsspfile "2ajqF.bssp"
#ERROR : Can't open dsspfile "3cymA.bssp"
#ERROR : Can't open dsspfile "1b43A.bssp"
#ERROR : Can't open dsspfile "1a76A.bssp"
#ERROR : Can't open dsspfile "3ce0A.bssp"
#ERROR : Can't open dsspfile "3dnhB.bssp"
#ERROR : Can't open dsspfile "3c2vA.bssp"
#ERROR : Can't open dsspfile "3b77C.bssp"
#ERROR : Can't open dsspfile "3c2oA.bssp"
#ERROR : Can't open dsspfile "2csbA.bssp"
#ERROR : Can't open dsspfile "3c94A.bssp"
#ERROR : Can't open dsspfile "2a0kA.bssp"
#ERROR : Can't open dsspfile "2eeeA.bssp"
#ERROR : Can't open dsspfile "1dgsA.bssp"
#ERROR : Can't open dsspfile "2csdA.bssp"
#ERROR : Can't open dsspfile "3b77F.bssp"
#ERROR : Can't open dsspfile "2e6lA.bssp"
#ERROR : Can't open dsspfile "2e2iH.bssp"
#ERROR : Can't open dsspfile "3b77A.bssp"
#ERROR : Can't open dsspfile "2bhnA.bssp"
#ERROR : Can't open dsspfile "2a1sA.bssp"
#ERROR : Can't open dsspfile "3e7dA.bssp"
#ERROR : Can't open dsspfile "2c5lD.bssp"
#ERROR : Can't open dsspfile "2bgwA.bssp"
#ERROR : Can't open dsspfile "2a1sD.bssp"
#ERROR : Can't open dsspfile "3e7dB.bssp"
#ERROR : Can't open dsspfile "2ejbA.bssp"
#ERROR : Can't open dsspfile "2a1sC.bssp"
#ERROR : Can't open dsspfile "3e7dC.bssp"
#ERROR : Can't open dsspfile "3c2eA.bssp"
#ERROR : Can't open dsspfile "3c1yA.bssp"
#ERROR : Can't open dsspfile "2d5rA.bssp"
#ERROR : Can't open dsspfile "2bgwB.bssp"
#ERROR : Can't open dsspfile "3cg7B.bssp"
#ERROR : Can't open dsspfile "2a1jA.bssp"

## Summary of PDB Search
:924
    e-180  35%  1bgxT  [c.120.1 - a.60.7 - c.55.3 - e.8.1] TAQ DNA POLYMERASE
    e-158  35%  1cmwA  [c.120.1 - a.60.7 - c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE
    e-134  37%  2bdpA  [c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE I)
    e-126  35%  1bdp-  [x.x.x] DNA POLYMERASE I
    e-120  43%  1d9dA  [c.55.3 - e.8.1] DNA POLYMERASE I
    e-113  43%  1d8yA  [c.55.3 - e.8.1] DNA POLYMERASE I
    e-106  16%  2ajqA  [x.x.x] T7 DNA POLYMERASE
    1e-99  18%  2ajqF  [x.x.x] T7 DNA POLYMERASE
    5e-57  10%  3cymA  [x.x.x] UNCHARACTERIZED PROTEIN BAD_0989
    1e-52  16%  1b43A  [c.120.1 - a.60.7] PROTEIN (FEN-1)
    4e-51  18%  1a76A  [x.x.x] FLAP ENDONUCLEASE-1 PROTEIN
    1e-47  12%  3ce0A  [x.x.x] POLY [ADP-RIBOSE] POLYMERASE 3
    1e-46  13%  3dnhB  [x.x.x] UNCHARACTERIZED PROTEIN ATU2129
    3e-46  12%  3c2vA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    3e-46   8%  3b77C  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-45  13%  3c2oA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    1e-37  13%  2csbA  [x.x.x] TOPOISOMERASE V
    7e-35  10%  3c94A  [x.x.x] EXODEOXYRIBONUCLEASE I
    5e-32  14%  2a0kA  [x.x.x] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    1e-28  12%  2eeeA  [x.x.x] UNCHARACTERIZED PROTEIN C6ORF130
    1e-26  18%  1dgsA  [d.142.2 - b.40.4 - a.60.2] DNA LIGASE
    2e-26  14%  2csdA  [x.x.x] TOPOISOMERASE V
    9e-26  10%  3b77F  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-25  17%  2e6lA  [x.x.x] WERNER SYNDROME ATP-DEPENDENT HELICASE HOMOLOG
    9e-24   9%  2e2iH  [x.x.x] DNA-DIRECTED RNA POLYMERASES I, II, AND III 14.5
    1e-21   7%  3b77A  [x.x.x] UNCHARACTERIZED PROTEIN
    5e-21  11%  2bhnA  [x.x.x] XPF ENDONUCLEASE
    7e-18  15%  2a1sA  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    3e-17  17%  3e7dA  [x.x.x] COBH, PRECORRIN-8X METHYLMUTASE
    1e-16  15%  2c5lD  [x.x.x] PHOSPHOINOSITIDE-SPECIFIC PHOSPHOLIPASE C
    2e-16  12%  2bgwA  [x.x.x] XPF ENDONUCLEASE
    3e-16  15%  2a1sD  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    4e-16  17%  3e7dB  [x.x.x] COBH, PRECORRIN-8X METHYLMUTASE
    4e-16  14%  2ejbA  [x.x.x] PROBABLE AROMATIC ACID DECARBOXYLASE
    2e-15  17%  2a1sC  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    4e-15  15%  3e7dC  [x.x.x] COBH, PRECORRIN-8X METHYLMUTASE
    1e-11  11%  3c2eA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    1e-10  15%  3c1yA  [x.x.x] DNA INTEGRITY SCANNING PROTEIN DISA
    8e-08  13%  2d5rA  [x.x.x] CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 7
    2e-05  14%  2bgwB  [x.x.x] XPF ENDONUCLEASE
    5e-05   8%  3cg7B  [x.x.x] CELL DEATH-RELATED NUCLEASE 4
    7e-05  21%  2a1jA  [x.x.x] DNA REPAIR ENDONUCLEASE XPF
:924

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxKKTDHFYLIDGSGYIFRAYYALPPLTRKSDGLPVGAVSGFCSMLFKLLEDSKSNENLQKPTHFAVI
1bgxT           ----EPKGRVLLVDGHHLAYRTFHALKGLT-TSRGEPVQAVYGFAKSLLKALKED--------GDAVIVV
1cmwA           --------RVLLVDGHHLAYRTFHALKGLT-TSRGEPVQAVYGFAKSLLKALKE--------DGDAVIVV
2bdpA           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
1d9dA           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
2ajqA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
3cymA           ----------------------------------------------------------------------
1b43A           -----------AIDALNAIYQFLSTIRQKDGTSKGRITSHLSGLFYRTINLMEA---------GIKPVYV
1a76A           -----------AIDGMNALYQFLTSIRSPLRNRKGEITSAYNGVFYKTIHLLEN---------DITPIWV
3ce0A           ----------------------------------------------------------------------
3dnhB           ----------------------------------------------------------------------
3c2vA           ----------------------------------------------------------------------
3b77C           ----------------------------------------------------------------------
3c2oA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------LTRRWIVEHKRD---------IRR
3c94A           ----------------------------------------------------------------------
2a0kA           -----------------------------------------------------------------HHRKI
2eeeA           ---------ITYVKGDLFACPKTDSLAHCISEDGAGIAVLFKKKFGGVQELLNQ-------QKKSGEVAV
1dgsA           -----------FIEGSEVSRVTLHNESYIEEL-DIRIGDWVLVHKAGGVIPEVL-RVLKERRTGKERPIR
2csdA           ----------------------------------------------LTRRWIVE-------HKRDIMRRY
3b77F           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
2e2iH           ----------------------------------------------------------------------
3b77A           ----------------------------------------------------------------------
2bhnA           --------------------------------EERSPVPSILESLGVQVIPKQLPM-------GDYLVSD
2a1sA           ----------------------------------------------------------------------
3e7dA           ----------------------------------------------------------------------
2c5lD           ----------------------------------------------------------------------
2bgwA           -------------------------------------YVDVREERSPVPSILESLGIPKQLPMGDYLVSD
2a1sD           ----------------------------------------------------------------------
3e7dB           ----------------------------------------------------------------------
2ejbA           -------------------------------------ASGVIYGIKLLQVLEE--------LDFSVDLVI
2a1sC           ----------------------------------------------------------------------
3e7dC           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2bgwB           --------------------------------------------------------------------VY
3cg7B           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FDAARKTFRNEIYSDYKANRSEAPDDLAPQFEYIRKSVVAFNLPSVDLPNYEADDLIATYVEQILAKGAK
1bgxT           FDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYE
1cmwA           FDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYE
2bdpA           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
1d9dA           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
2ajqA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
3cymA           ----------------------------------------------------------------------
1b43A           FDGEPPEFKKGEIEEARKYAQRATRVNEMLIEDAKKLLELMGIPIVQAP-SEGEAQAAYMAAK----GSV
1a76A           FDGEPPKLKEKTFEEAAKYAKRVSYLTPKMVENCKYLLSLMGIPYVEAP-SEGEAQASYMA----KKGDV
3ce0A           ----------------------------------------------------------------------
3dnhB           ----------------------------------------------------------------------
3c2vA           ----------------------------------------------------------------------
3b77C           ----------------------------------------------------------------------
3c2oA           ----------------------------------------------------------------------
2csbA           YLEQRIVECALKLQDRYGIREDVARAFDGSISIATTPYRTLKDVCPDLTLEEAKSVNRT-----LATLID
3c94A           ----------------------------------------------------------------------
2a0kA           YIAGPAVFNPDGASYYNKVRELLKKENVPLIPTDNEATEALDIRQKNIQIKDCDAVIADLSPFRGGTAFE
2eeeA           LKRDGRYIYYLITKKRASHK-PTYENLQKSLEAMKSHCLKNGVTDLSMPRLQWENVSAMIEEVFEATDIK
1dgsA           WPEACPECGHRLVKEGKVHRCPNPLCPAKRFEAIRHYA-----------SRKAMDIEGLGEKLIER-LLE
2csdA           LEQRIVECALKLQDRYGI-REDVALCLARAFDGSISPYRTLKDVCPDLTLEEAKSVNRTLATLIDEHG--
3b77F           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
2e2iH           ----------------------------------------------------------------------
3b77A           ----------------------------------------------------------------------
2bhnA           SIIVERKTSSDFAKSLFDGRLFEQASRLAEHYE-TVFIIVEGPPVPRRYRGRERSLYAAMAALQLDYGIR
2a1sA           ----------------------------------------------------------------------
3e7dA           ----------------------------------------------------------------------
2c5lD           ----------------------------------------------------------------------
2bgwA           SIIVERKTSSDFAKSLFDGRLFEQASRLAEHY-ETVFIIVEGPPVPRRYRGRERSLYAAMAALQLDYGIR
2a1sD           ----------------------------------------------------------------------
3e7dB           ----------------------------------------------------------------------
2ejbA           SRNAKVVLKEEVLKGLKNVRIHEENDFTSPLASGSRLVHCSTNTLSCIANGINKNLIHRVGEVALKERVP
2a1sC           ----------------------------------------------------------------------
3e7dC           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2bgwB           VDV--REERSPVPSILESLGVQIPKQLPMGDYLVSDSIIVERKTSSDFAKSLFDGRLFEQASRLAEYETV
3cg7B           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VTIVSSDKDLMQLYRKDVRIFDPMKNKFITPEDIVTKFGVGPEKVIDVQSLAGDSSDNVPGVPGIGVKTA
1bgxT           VRILTADKDLYQLLSDRIHVLHPEGYLI-TPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTA
1cmwA           VRILTADKDLYQLLSDRIHVLHPEG-YLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTA
2bdpA           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
1d9dA           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
2ajqA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
3cymA           ----------------------------------------------------------------------
1b43A           YASASQDYDSLLFGAPRLVRNLTITGKRKLPEEVLKELKLTREKLIEL-AILVGTDYNPGGIKGIGLKKA
1a76A           WAVVSQDYDALLYGAPRVVRNLTTTKELIELNEVLEDLRISLDDLIDIAIFMGTD-YNPGGVKGIGFKRA
3ce0A           ----------------------------------------------------------------------
3dnhB           ----------------------------------------------------------------------
3c2vA           ----------------------------------------------------------------------
3b77C           ----------------------------------------------------------------------
3c2oA           ----------------------------------------------------------------------
2csbA           E-HGLSPDAADELIEHFESIAGILATDLE----EIERYEEGRLSEEAYRAAVEIQLAELTKKEGVGRKTA
3c94A           ----------------------------------------------------------------------
2a0kA           VGCAAALNKVLTFTSDRRNR-EKYGSGVDKDNLRVEGFGLPFNLLYD-GVEVFDSFESAF----------
2eeeA           ITVYT-----------------------------------------------------------------
1dgsA           KGLVRDVADLYHLRKEDLLGLERMGEK---------SAQNLLRQIEESKHRGLERLLYALGLPGVGEVLA
2csdA           ----LSPDAADELIEHFESIAGILATDLEEIERMYEEGRLSEE---AYRAAVEIQLAELTKKEGVGRKTA
3b77F           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
2e2iH           ----------------------------------------------------------------------
3b77A           ----------------------------------------------------------------------
2bhnA           LMNTMDPKGTALVIESLARLSTREGG-----------QRIVIHKKPRLSDVREWQLYILQSFPGIGRRTA
2a1sA           ----------------------------------------------------------------------
3e7dA           ----------------------------------------------------------------------
2c5lD           ----------------------------------------------------------------------
2bgwA           LMNTMDPKGTALV-----------IESLARLSTREGGQRIVIHKKPRLSDVREWQLYILQSFPGIGRRTA
2a1sD           ----------------------------------------------------------------------
3e7dB           ----------------------------------------------------------------------
2ejbA           LVLLVREAPYNEIHLENMLKITRMGGVVVPA---SPAFYHKPQSIDDMINFVVGKLLDVLRIEH------
2a1sC           ----------------------------------------------------------------------
3e7dC           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3c1yA           IMDYSSEEVEEETAQNILQDFITRRE--PSPISISRGYDVQQAAQLDDVLVSARGYRLLKTVARIPLSIG
2d5rA           ----------------------------------------------------------------------
2bgwB           FIIVEGPPVPRRYRGRERSLYAAMAALQLDYGIRLMIESLARLSTKPRLSVREWQLYILQSFPGIGRRTA
3cg7B           ----------------------------------------------------------------------
2a1jA           -------------------------------------------------------QDFLLKMPGVNAKNC


                         .         .         .         +         .         .         .:280
query           AELINKYGTLEKLLDNAQEIKQNKRRETLIENKDKAIISKKLVTLMKDAPVERKLEEFHLKKIDKNKLYK
1bgxT           RKLLEEWGSLEALLKNLDRLKP-AIREKILAHMDDLKLSWDLAKVRTDLPLEVDFAK--RREPDRERLRA
1cmwA           RKLLEEWGSLEALLKNLDRLKP-AIREKILAHMDDLKLSWDLAKVRTDLPLEVDFAK--RREPDRERLRA
2bdpA           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
1d9dA           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
2ajqA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
3cymA           ----------------------------------------------------------------------
1b43A           LEIVRHSKDPLAKFQKQSDVDLYAIKEFFLNPPVTDNYNLVWRDPDEEGILKFLCDEHD---FSEERVKN
1a76A           YELVRSGVAKDVLKKEVEYYD--EIKRIFKEPKVTDNYSLSLKLPDKEGIIKFLVDE---NDFNYDRVKK
3ce0A           ----------------------------------------------------------------------
3dnhB           ----------------------------------------------------------------------
3c2vA           ----------------------------------------------------------------------
3b77C           ----------------------------------------------------------------------
3c2oA           ----------------------------------------------------------------------
2csbA           ERLLRAFGNPERVKQLAREFEIEKLASVEGVGERVLRSLVPGYASLISIRGIDRERAERLLKGYSKVREA
3c94A           ----------------------------------------------------------------------
2a0kA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1dgsA           RNLARRFGTMDRLLEASLE---------------------------------------------------
2csdA           ERLLRAFGNPERVKQLAREFEIEKLASVEGVGERVLRSLVPGYASLISIRGIDRERAERL----------
3b77F           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
2e2iH           ----------------------------------------------------------------------
3b77A           ----------------------------------------------------------------------
2bhnA           ERILERFGSLERFFTASKA---------------------------------------------------
2a1sA           ----------------------------------------------------------------------
3e7dA           ----------------------------------------------------------------------
2c5lD           ----------------------------------------------------------------------
2bgwA           ERILERFGSLERFFT-------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
3e7dB           ----------------------------------------------------------------------
2ejbA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e7dC           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3c1yA           YNVVRMFKTLDQISKASVEDLKKKRARAISE---------------------------------------
2d5rA           ----------------------------------------------------------------------
2bgwB           ERILERFGSLERFFTASKA---------------------------------------------------
3cg7B           ----------------------------------------------------------------------
2a1jA           RSLMHHVKNIAELAALSQD---------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FLREMEFNRLLSSVISAYGEPLLXXXXXXXXXXXXHQNISKKNYHLITNEKEIDEWINEAEEAGELAIDT
1bgxT           FLERLEFGSLL-----------------------------------------------HEFGLLESPKAL
1cmwA           FLERL----------------------------------------------EFGSLLHEFGLLESPAL--
2bdpA           -------------------------------------------------AFTLADRVTEEMLADKAALVV
1bdp-           ------------------------------------------------MAFTLADRVTEEMLADKAALVL
1d9dA           --------------------------------------ISYDNYVTILDEETLKAWIAKLEKAPVFAFDT
1d8yA           --------------------------------------ISYDNYVTILDEETLKAWIAKLEKAPVFAFAT
2ajqA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
3cymA           ------------------------------------AEPREGVPNVIDTLPAFRDYCSEASSHGSLAADA
1b43A           GLERLKKAIKSG----------------------------------------------------------
1a76A           HVDKLYNLIANKT---------------------------------------------------------
3ce0A           ----------------------------------------------------------------------
3dnhB           ----------------------------------------------------------------------
3c2vA           ----------------------------------------------------------------------
3b77C           ----------------------------------------------------------------------
3c2oA           ----------------------------------------------------------------------
2csbA           GVEELREDGLT-----------------------------------------------------------
3c94A           ------------------------------------------------------------QQSTFLFHDY
2a0kA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
3b77F           ----------------------------------------------------------------------
2e6lA           ------------------------------------------SIVYSYEASDCSFLSEDISDGDVVGFDM
2e2iH           ----------------------------------------------------------------------
3b77A           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
3e7dA           ----------------------------------------------------------------------
2c5lD           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
3e7dB           ----------------------------------------------------------------------
2ejbA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e7dC           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
3cg7B           ---------------------------------------------------------------VPNDKIR
2a1jA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ETSSLDAHQTDLVGISLSTKIGQACYIPIGHKFKGCLKKETVIKKLKPLLEDKSVKKIGQNIKFDFIVLY
1bgxT           EEAPWPPPEGAFVGFVLSRKEPMWADLLALAAARG----GRVHRAPEPYKALRDLKEARGLLAKDLSVLA
1cmwA           EEAPWPPPEGAFVGFVLSR--KEPMWADL--LALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVLA
2bdpA           EVVEENYHDAPIVGIAVVNEHGRFFLRPETAL---------ADPQFVAWLGDETKKKSMFDSKRAAVALK
1bdp-           EVVEENYHDAPIVGIAVVNEHGRFFLRPETAL---------ADPQFVAWLGDETKKKSMFDSKRAAVALK
1d9dA           ETDSLDNISANLVGLSFAIEPGVAAYIPVAHDYLDAISRERALELLKPLLEDEKALKVGQNLKYDRGILA
1d8yA           ATDSLDNISANLVGLSFAIEPGVAAYIPVAHDYLDAISRERALELLKPLLEDEKALKVGQNLKYDRGILA
2ajqA           -------------------------------------------------------NEEMMDYNVQDVVVT
2ajqF           ----------------------------------------------------------------------
3cymA           ERASGFRYGHEDWLVQFKRDGAGIGLLDPQAL------AAAGADWNDFNRAVGDAVWILHDSLQDLPGFD
1b43A           ----------------------------------------------------------------------
1a76A           ----------------------------------------------------------------------
3ce0A           ----------------------------------------------------------------------
3dnhB           ----------------------------------------------------------------------
3c2vA           ----------------------------------------------------------------------
3b77C           ----------------------------------------------------------------------
3c2oA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
3c94A           ETFGTHPALDRPAQFAAIRTDSEFNVIGEPEVFAKGENEAAFAARIHSLFTPKTCILGYNNVRFDDEV-T
2a0kA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
3b77F           ----------------------------------------------------------------------
2e6lA           EWPPPG-KRSRVAVIQLCVSESKCYLFHISSM-------SVFPQGLKMLLENKSIKKAGVGIEGDQWKLL
2e2iH           ----------------------------------------------------------------------
3b77A           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2a1sA           ------------------------------------LNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTV
3e7dA           ----------------------------------------------------------------------
2c5lD           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2a1sD           ------------------------------------LNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTV
3e7dB           ----------------------------------------------------------------------
2ejbA           ----------------------------------------------------------------------
2a1sC           ------------------------------------LNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTV
3e7dC           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2d5rA           -----------------------------------------LMTSGVVLCEGVKWL--SFHSGYDFGYLI
2bgwB           ----------------------------------------------------------------------
3cg7B           EDISFNKYVKPVLNRTLTKNCVDFTGIPQRSIDTADTFDVVYEQFLITLGLEEGKFAFVCDSRQDLWRIA
2a1jA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KQGINMNSMEDTMLMSYVLDAGKNRHNMDTLSEIHLQHKTISFKEIVGTGKKEINFSDVELDKAMEYAAE
1bgxT           LRELGLPPGDDPMLLAYLLDPS--NTTPEGVARRYGG-------------------------EWTEEAGE
1cmwA           LRELGLPPGDDPMLLAYLLDPSN--TTPEGVARRYGG-------------------------EWTEEAGE
2bdpA           WKGIELGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDE---PVLAEHLVR
1bdp-           WKGIELGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYG---KGAKRAVPDEPVLAEHLVR
1d9dA           NYGIELRGAFDTMLESYILNSVAGRHDMDSLAERWLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAE
1d8yA           NYGIELRIAFDTMLESYILNSVAGRHDMDSLAERWLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAE
2ajqA           KALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVELAA
2ajqF           --------QDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPF
3cymA           ELGMEPQRLFDTEIAARLLGLK--RFGLAAVTEHFLGLTLAKEHSAADWSYRPL------PRDWRNYAAL
1b43A           ----------------------------------------------------------------------
1a76A           ----------------------------------------------------------------------
3ce0A           -----------------------------------------------------------------CSLDP
3dnhB           ----------------------------------------------------------------------
3c2vA           ----------------------------------------------------------------------
3b77C           ----------------------------------------------------------------------
3c2oA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
3c94A           RNIFYRNFYDPYAWSWQHDNSRWDLLDVMRACYALRPEGINWPENDDGLPSFRLEHLTKANGIEHSDAMA
2a0kA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
3b77F           ----------------------------------------------------------------------
2e6lA           RDDVKLESFVELTDVANEKLKCAETWSLNGLVKHVLGKQLLKDKSIRCSNWSNFPLT----EDQKLYAAT
2e2iH           --------------------------------------SNTLFDDIFQSEVDPGRYNKVCRIEAASTTQD
3b77A           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2a1sA           HQFYCPPRLLDTKLMASTQPFKDNNTSLAELEKRLKETP---------FNPPKVESAEGFPSYQLHEAGY
3e7dA           ----------------------------------------------------------------------
2c5lD           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2a1sD           HQFYCPLRLLDTKLMASTQPFKDINTSLAELEKRLKETPF---------NPPKVESAEGFPSYQLHEAGY
3e7dB           ----------------------------------------------------------------------
2ejbA           ----------------------------------------------------------------------
2a1sC           HQFYCPPRLLDTKLMASTQPFKDNNTSLAELEKRLKETPFNPPKVESA---------EGFPSYQLHEAGY
3e7dC           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2d5rA           KILTNPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLE----------LERIGPQHQAGS
2bgwB           ----------------------------------------------------------------------
3cg7B           QYQMKLSNIQMPAFFRQYINLYKIFTN-------EMDRMGPKELSATTNIGKMNEYYDLPTIGRAHDAMD
2a1jA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DADITYRLYKIFSKNLKLEKLTNIYEIFEKPLIKILAFMEIEGIKIDNKFLKVLSEKFEKKISKLEKEVF
1bgxT           RAALSERLFNLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVF
1cmwA           RAALSERLFANLWGRLEEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVA-----LEAEVF
2bdpA           KAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIY
1bdp-           KAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELREKLGTVEQRIY
1d9dA           DADVTLQLHLKMWPDLQKHGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEKKAH
1d8yA           DADVTLQLHLKMWPDLQKHKPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEKKAH
2ajqA           LRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELYVAGAPYT
2ajqF           DTKAIEELYVELAARRSERKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKLDTREYVAGAPYT
3cymA           DVELLIELETKMRAELKRQGKMEWAQEEFDYAL-----KEGLGPRKEHLIPWMHVSHITEVMRDRQALAI
1b43A           ----------------------------------------------------------------------
1a76A           ----------------------------------------------------------------------
3ce0A           ATQKLITN--IFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEALKDGGQSLEELSSHFY
3dnhB           ----------------------------------------------------------------------
3c2vA           ----------------------------------------------------------------------
3b77C           ----------------------------------------------------------------------
3c2oA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
3c94A           DVYATIAMAVPQMKPLVHVSGMFGAWRGNTSWVAPLAWHPENRNAVIMVDLAGDISPLLELDSDTLRERL
2a0kA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
3b77F           ----------------------------------------------------------------------
2e6lA           DAYAGLIIYQKLGN--------------------------------------------------------
2e2iH           QCKLTLDINVELFPVAAQDSL-------TVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEAVYY
3b77A           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2a1sA           DAYITGLCFISMANYLGFLSPPKIHVSARSKLIEFFNKLFLMRVM-------------------------
3e7dA           ----------------------------------------------------------------------
2c5lD           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2a1sD           DAYITGLCFISMANYLGFLSPPKIHVSARSKLIEPFF---------------------------------
3e7dB           ----------------------------------------------------------------------
2ejbA           ----------------------------------------------------------------------
2a1sC           DAYITGLCFISMANYLGSFIHVSARSKLIEPFFNKLFLMRVMDI--------------------------
3e7dC           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2d5rA           DSLLTGMAFFKMREMFFEDHIDDAKY--------------------------------------------
2bgwB           ----------------------------------------------------------------------
3cg7B           DCLNIATILQRMINMGAKVTVNELLTCCASWRRQPLVYNKEWVTTIRAGDFRKGMDVCGTSHQQTPHDLY
2a1jA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KISKKEFNIASPKQLGEIIYNDLKIAVLKKTRKGSFATNASVLEDLAFKGHEFPKLILDWRQVSKLKNTY
1bgxT           RLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKSTSAAVLEALREA-HPIVEKILQYRELTKLKSTY
1cmwA           RLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRTSAAVLEALREA-HPIVEKILQYRELTKLKSTY
2bdpA           ELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTG-YSTSADVLEKLAPY-HEIVENILHYRQLGKLQSTY
1bdp-           ELAGQEFNINSPKQLGVILFEKLQLPVLYSTSADVLEKL--------APYHEIVENILHYRQLGKLQSTY
1d9dA           EIAGEEFNLSSTKQLQTILFEKQGIKPLKKTPSTSEEVLEELALD-----YPLPKVILEYRGLAKLKSTY
1d8yA           EIAGEEFNLSSTKQLQTILFEKQGIKPLKKTPSTSEEVLEELALD-----YPLPKVILEYRGLAKLKSTY
2ajqA           PVEHVVFNPSSRDHIQKKLQEAGWV-PTKYTDKGAPVVDDEVLEGVRVDKQAAIDLIKEYLMIQKRIGQS
2ajqF           PVEHVVFNPSSRDHIQKKLQEAGWVPT-KYTDKGAPVVDDEVLEGVRVDDQAAIDLIKEYLMIQKRIGQS
3cymA           VRALWTRRDELAREYDIAPTLLLSDSSIIEVAKRKPHNA-----------AQFRSIRSINERVRIHTDSE
1b43A           ----------------------------------------------------------------------
1a76A           ----------------------------------------------------------------------
3ce0A           TVIPHNFGHSQPPPINS---------------PELLQAKKDMLL--VLADIELAQALQAVSEQEKTVEEV
3dnhB           ----------------------------------------------------------------------
3c2vA           ----------------------------------------------------------------------
3b77C           ----------------------------------------------------------------------
3c2oA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
3c94A           ----YTAKTDLNAAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHC-LDNLKILRENPQVREKVVAI
2a0kA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
3b77F           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
2e2iH           SFGGLLMRLEGNYRLNNLKQENAYLLIRR-----------------------------------------
3b77A           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
3e7dA           ----------------------------------------------------------------------
2c5lD           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
3e7dB           ----------------------------------------------------------------------
2ejbA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e7dC           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
3cg7B           KNEEDPIHFAKI----------------------------------------------------------
2a1jA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SDALPEHINPNTKRVHTSFLLAATTTGRLASSDPNLQNIPIKSEDGKDIRKAFIAEKGFTLISADYNQIE
1bgxT           IDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIE
1cmwA           IDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIE
2bdpA           IEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWIFAADYSQIE
1bdp-           IEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDLIFAADYSQIE
1d9dA           TDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFIAPEDYVIVSADYSQIE
1d8yA           TDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFIAPEDYVIVSADYSQIE
2ajqA           AEGDKLRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFITGKPWVQAGIDASGLE
2ajqF           AEGDKAWLRAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFITGKPWVQAGIDASGLE
3cymA           QDKMFERYAPIQRKIKPSMWKNIIQDALALPPSEWPDSAPKSIRVWKERYPERLQVLNRVRKAVSQIAED
1b43A           ----------------------------------------------------------------------
1a76A           ----------------------------------------------------------------------
3ce0A           PHPLDRDYQLLKCQLQLLDIQTYLEQTGSNHRCPTLQHIWKVNQEGEEDRFQAHS-----------KLGN
3dnhB           -------------------------------APPVITPRGAPFEAVRVARDVLHTSRTAALLDPVSGYPY
3c2vA           ---------------------------------PVYEHLPVNGAWRQDVTNWLSEDVPSFDFGGYV-VGS
3b77C           -------------------------------------------------------DIGQVIHPDDFDKAA
3c2oA           ---------------------------------PVYEHLPVNGAWRQDVTNWLSEDVPSFDFGGYV-VGS
2csbA           ----------------------------------------------------------------------
3c94A           FASDNVDA---QLYNGFFSDADRAAMKIVLETEPNLPALDITFVDKRIEKLLFNYRARNYAEQQRWLEHR
2a0kA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
3b77F           ---------------------------------------------------------GQVIHPDDFDKAA
2e6lA           ----------------------------------------------------------------------
2e2iH           ----------------------------------------------------------------------
3b77A           -------------------------------------------------------DIGQVIHPDDFDKAA
2bhnA           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
3e7dA           -------------------------------------------RDGQAIYDAIIREADLRHIPADLEKLA
2c5lD           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
3e7dB           -------------------------------------------RDGQAIYDAIIREADLRHIPADLEKLA
2ejbA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e7dC           -------------------------------------------RDGQAIYDAIIAEADLRHIPADLEKLA
3c2eA           ---------------------------------PVYEHLPVNGAWRQDVTNWLSEDVPS-FDFGGYVVGS
3c1yA           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
3cg7B           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           MRILADLAEVKELKKAFSNNEDIHSLTASQVFNVDIKKVDQDMRRKAKAINFGIIYGISQYGLAKQINVS
1bgxT           LRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIP
1cmwA           LRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIP
2bdpA           LRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNIS
1bdp-           LRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNIS
1d9dA           LRIMAHLSRDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINFGLIYGMSAFGLARQLNIP
1d8yA           LRIMAHLSRDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINFGLIYGMSAFGLARQLNIP
2ajqA           LRCLAHFMA------RFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
2ajqF           LRCLAHFMA------RFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
3cymA           TRTPVEIVIKPQYLRNLCWTDEPRKRDVARFLSEQ--GARDWQVSLVAESVSRAIEG-------------
1b43A           ----------------------------------------------------------------------
1a76A           ----------------------------------------------------------------------
3ce0A           RKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYKSAGYVIGMKCGAHHVGYMFLGEVLGREHHINTD
3dnhB           TTATNIGIEPDGTPFFFAAGLTLHARNETDARVTLAPFGKGDALTLPRLTLVGRADRI-----------G
3c2vA           DLKEANLYCKQDGMLCGV---PFAQEVFNQCELQVEWLFKEGSFLEPSKNDSGKIVVAKITGPAKNI---
3b77C           ADDYVLHEDGEKIYFLIKSKTDEYCFTNLALVHLDGSKRVLYRYPYAHYPIRHVFETAGTVDLDVEIKFE
3c2oA           DLKEANLYCKQDGMLCG---VPFAQEVFNQCELQVEWLFKEGSFLEPSKNDSGKIVVAKITGPAKNILLA
2csbA           ----------------------------------------------------------------------
3c94A           RQVFTPEDELQMLVQQYADDKEKVALLKA-----------------------------------------
2a0kA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
3b77F           ADDYVLHEDGEKIYFLIKSKTDEYCFTNLALVHLDGKRVLY-RYPYAHYPIRHVFETAGTVDLDVEIKFE
2e6lA           ----------------------------------------------------------------------
2e2iH           ----------------------------------------------------------------------
3b77A           ADDYVLHEDGEKIYFLIKSKTDEYCFTNLALVGESASKRVLYRYPYAHYPIRHVFETAGTVDLDVEIKFE
2bhnA           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
3e7dA           VRVIHACGMVDVANDLAFSEGAGKAGRNALLAGAPIRMVAEGITRSRLPADNRVIYTLSDPSVPKKIGNT
2c5lD           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
3e7dB           VRVIHACGMVDVANDLAFSEGAGKAGRNALPILCDARMVAEGITRSRLPADNRVIYTLSDPSVPKKIGNT
2ejbA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e7dC           VRVIHACGMVDVANDLAFSEGAGKAGRNALLAGADARMVAEGITRSRLPADNRVIYTLSDPSVPELAKKI
3c2eA           DLKEANLYCKQDGMLCG---VPFAQEVFNQCELQVEWLFKEGSFLEPSKNDSGKIVVAKITGPAKNILLA
3c1yA           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
3cg7B           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           NHEADEFLNAYFLKFPEIKIYMDNTIKFCRKSGYVTNIFGRRSHFNGINDKNFNVRNFQERAAINAPIQG
1bgxT           YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
1cmwA           YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
2bdpA           RKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQG
1bdp-           RKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQG
1d9dA           RKEAQKYMDLYFERYPGVLEYMERTRAQAKEQGYVETLDGRRLYLPDIKSSNGARRAAAERAAINAPMQG
1d8yA           RKEAQKYMDLYFERYPGVLEYMERTRAQAKEQGYVETLDGRRLYLPDIKSSNGARRAAAERAAINAPMQG
2ajqA           KERGKELKKKFLENTPAIAALRESIQQTSQWVAGEQQVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
2ajqF           KERGKELKKKFLENTPAIAALRESIQQTSQWVAGEQQVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
3cymA           ----------------------------------------------------------------------
1b43A           ----------------------------------------------------------------------
1a76A           ----------------------------------------------------------------------
3ce0A           NPSLKSPPPGFDSVIARGHTEPDPTQDTELELD-------------------------------------
3dnhB           PDEVPLAIARYIARYPKAKLYLSLPYRLRTEGVQINGNITPADLRTDLSGAE-ELAAAESEATRLNAIKG
3c2vA           -LLAERTALNILSRSSGIATASHKIISLARSTGYKGTIAGTRKTTPGLR--RLEKYSMLVGGCDTHRYDL
3b77C           IGGKHYSIDVDKKQLEHVKDLYK-ALLAIAEKQYEGQKLEFANSSLNHSVTILGGLRQQTFKDLSQESFD
3c2oA           ERTALNILSRS----SGIATASHKIISLARSTGYKGTIAGTRKTTPGL--RRLEKYSMLVGGCDTHRYDL
2csbA           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
2a0kA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
3b77F           IGGKHYSIDVDKKQLEHVKDLY-KALLAIAEKQYEGQKLEFANSSLNHSVTI----LGGLRQGDNVPQTF
2e6lA           ----------------------------------------------------------------------
2e2iH           ----------------------------------------------------------------------
3b77A           IGGKHYSIDVDKKQLEHVKDLYKALLAINSSLNHSVTILGGLRQGDNVPQTFKDLSQESFDWLQGHYYKW
2bhnA           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
3e7dA           RSAAALDLWLPHIEGSIVAIGNAPTALFRLFELLDAGAPKPALIIGMPVGFVGAAESKDELAARGVP---
2c5lD           -----------------------------------------------------DVSPEQPRTVIKAPRVS
2bgwA           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
3e7dB           RSAAALDLWLPHIEGSIVAIGNAPTALFRLFELLDAGAPKPALIIGMPVGFVGAAESKDELAANS---RG
2ejbA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e7dC           GNTLFRLFELLDAGAPKPALIIGMPVGFVGAAESKDELAANSRGVPYVIVRGRRGGSAMTAAAVNA----
3c2eA           ERTALNILSRSSGIATASHKIISLARSTG-----------------------------------------
3c1yA           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
3cg7B           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           SASEIMRLAMIRLNKKFESIKNNKSKILLQIHDELIFEVPVKEVKNITEIIKDEMTSVTESDLHTFSTPL
1bgxT           TAADLMKLAMVKLFPRLE---EMGARMLLQVHDELVLEAAEAVARLAKEVMEGVY---------PLAVPL
1cmwA           TAADLMKLAMVKLFPRLEEM---GARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP-----LAVPL
2bdpA           SAADIIKKAMIDLNARLKE-ERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVT-----LRVPL
1bdp-           SAADIIKKAMIDLNARLKE-ERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVT-----LRVPL
1d9dA           TAADIIKRAMIAVDAWLQA-EQPRVRMIMQVHDELVFEVHKDDVDAVAKQIHQLMENCTR-----LDVPL
1d8yA           TAADIIKRAMIAVDAWLQA-EQPRVRMIMQVHDELVFEVHKDDVDAVAKQIHQLMENCTR-----LDVPL
2ajqA           AGALICKLWIIKTEEMLVHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHW-NFRCLL
2ajqF           AGALICKLWIIKTEEMLVHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHW-NFRCLL
3cymA           ----------------------------------------------------------------------
1b43A           ----------------------------------------------------------------------
1a76A           ----------------------------------------------------------------------
3ce0A           ----------------------------------------------------------------------
3dnhB           EASRLAVLAGAKTGRWKI-TSIDPDGIDLASASDLAFAERVETLKQFEKALA------------------
3c2vA           SSMVMLKDNHIWATGSITN-AVKNARAVCGFAVKIEVECLSEDE--ATEAIEAGADVI----MLDNHFLL
3b77C           WLQGHYYKWNQKDFGSFYE---------------------------------------------------
3c2oA           SSMVMLKDNHIWATGSITN-AVKNARAVCGFAVKIEVECL--SEDEATEAIEAGADVI----MLDNHFLL
2csbA           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
2a0kA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
3b77F           KDLSQESFDWL-----------QGHYYKWNQKDFSFYE--------------------------------
2e6lA           ----------------------------------------------------------------------
2e2iH           ----------------------------------------------------------------------
3b77A           NQKDF-----------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
3e7dA           ----------------------------------------------------------------------
2c5lD           TAQDVIQQTLCKA---------KYSLSILSNPNPSDYVLLEEVSQRVLLDQECVF---------KFILKL
2bgwA           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
3e7dB           VPYVIVRGRR------------------------------------------------------------
2ejbA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e7dC           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
3cg7B           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           TVDVNTGDNWGILH
1bgxT           EVEVGIGEDWLSAK
1cmwA           EVEVGIGEDWLSAK
2bdpA           KVDYHYGSTWY---
1bdp-           KVDYHYGSTWY---
1d9dA           LVEVGSGENWDQAH
1d8yA           LVEVGSGENWDQAH
2ajqA           DTEGKMGPNWAICH
2ajqF           DTEGKMGPNWAICH
3cymA           --------------
1b43A           --------------
1a76A           --------------
3ce0A           --------------
3dnhB           --------------
3c2vA           ECSGGLNLDNLY--
3b77C           --------------
3c2oA           ECSGGLNLCDDI--
2csbA           --------------
3c94A           --------------
2a0kA           --------------
2eeeA           --------------
1dgsA           --------------
2csdA           --------------
3b77F           --------------
2e6lA           --------------
2e2iH           --------------
3b77A           --------------
2bhnA           --------------
2a1sA           --------------
3e7dA           --------------
2c5lD           KE------------
2bgwA           --------------
2a1sD           --------------
3e7dB           --------------
2ejbA           --------------
2a1sC           --------------
3e7dC           --------------
3c2eA           --------------
3c1yA           --------------
2d5rA           --------------
2bgwB           --------------
3cg7B           --------------
2a1jA           --------------