[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21058.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ay0A.bssp"
#ERROR : Can't open dsspfile "2e6kA.bssp"
#ERROR : Can't open dsspfile "2bfcB.bssp"
#ERROR : Can't open dsspfile "1dtwB.bssp"
#ERROR : Can't open dsspfile "2bp7B.bssp"
#ERROR : Can't open dsspfile "3cznA.bssp"
#ERROR : Can't open dsspfile "3a17E.bssp"
#ERROR : Can't open dsspfile "3bvuA.bssp"
#ERROR : Can't open dsspfile "3cx3A.bssp"
#ERROR : Can't open dsspfile "2bp7A.bssp"
#ERROR : Can't open dsspfile "2beuA.bssp"
#ERROR : Can't open dsspfile "2bffA.bssp"
#ERROR : Can't open dsspfile "3cx3B.bssp"
#ERROR : Can't open dsspfile "3a17A.bssp"
#ERROR : Can't open dsspfile "3a15A.bssp"
#ERROR : Can't open dsspfile "1dtwA.bssp"
#ERROR : Can't open dsspfile "2bfdA.bssp"
#ERROR : Can't open dsspfile "2bfeA.bssp"
#ERROR : Can't open dsspfile "3bvgA.bssp"
#ERROR : Can't open dsspfile "3dv0A.bssp"
#ERROR : Can't open dsspfile "1dkhA.bssp"
#ERROR : Can't open dsspfile "3dv0E.bssp"
#ERROR : Can't open dsspfile "3dvaE.bssp"
#ERROR : Can't open dsspfile "2bfbA.bssp"
#ERROR : Can't open dsspfile "2bfcA.bssp"
#ERROR : Can't open dsspfile "3bvmA.bssp"
#ERROR : Can't open dsspfile "3dvaA.bssp"
#ERROR : Can't open dsspfile "3a18D.bssp"
#ERROR : Can't open dsspfile "2aq3D.bssp"
#ERROR : Can't open dsspfile "2d81A.bssp"
#ERROR : Can't open dsspfile "3dv0C.bssp"
#ERROR : Can't open dsspfile "2d80A.bssp"
#ERROR : Can't open dsspfile "3dv0G.bssp"
#ERROR : Can't open dsspfile "1cp9B.bssp"
#ERROR : Can't open dsspfile "1b2vA.bssp"
#ERROR : Can't open dsspfile "3ddrC.bssp"
#ERROR : Can't open dsspfile "2cxhA.bssp"
#ERROR : Can't open dsspfile "3ea4A.bssp"
#ERROR : Can't open dsspfile "2c31A.bssp"

## Summary of PDB Search
:967
    9e-68  12%  1ay0A  [c.36.1 - c.36.1 - c.48.1] TRANSKETOLASE
    9e-64  16%  2e6kA  [x.x.x] TRANSKETOLASE
    9e-57  18%  2bfcB  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT
    3e-55  17%  1dtwB  [c.36.1 - c.48.1] BRANCHED-CHAIN ALPHA-KETO ACID
    4e-51  15%  2bp7B  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT
    4e-49   9%  3cznA  [x.x.x] ALPHA-MANNOSIDASE 2
    8e-49   9%  3a17E  [x.x.x] ALDOXIME DEHYDRATASE
    3e-44   7%  3bvuA  [x.x.x] ALPHA-MANNOSIDASE 2
    2e-42  12%  3cx3A  [x.x.x] LIPOPROTEIN
    2e-42  14%  2bp7A  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    4e-41  13%  2beuA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    6e-41  14%  2bffA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    3e-40  13%  3cx3B  [x.x.x] LIPOPROTEIN
    9e-40   8%  3a17A  [x.x.x] ALDOXIME DEHYDRATASE
    1e-39   6%  3a15A  [x.x.x] ALDOXIME DEHYDRATASE
    8e-38  13%  1dtwA  [c.36.1] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    3e-37  13%  2bfdA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    4e-37  12%  2bfeA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    1e-35  15%  3bvgA  [x.x.x] ENTEROTOXIN TYPE C-3
    4e-35  16%  3dv0A  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    7e-35  16%  1dkhA  [d.35.1] HEME-BINDING PROTEIN A
    7e-35  14%  3dv0E  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-34  14%  3dvaE  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-34  13%  2bfbA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-34  13%  2bfcA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    7e-34  14%  3bvmA  [x.x.x] ENTEROTOXIN TYPE C-3
    2e-33  15%  3dvaA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    6e-33   8%  3a18D  [x.x.x] ALDOXIME DEHYDRATASE
    6e-32  15%  2aq3D  [x.x.x] ENTEROTOXIN TYPE C-3
    1e-31   9%  2d81A  [x.x.x] PHB DEPOLYMERASE
    2e-31  14%  3dv0C  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    7e-31  12%  2d80A  [x.x.x] PHB DEPOLYMERASE
    4e-30  16%  3dv0G  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    5e-30   9%  1cp9B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    1e-29  16%  1b2vA  [d.35.1] PROTEIN (HEME-BINDING PROTEIN A)
    2e-28  18%  3ddrC  [x.x.x] HEMOPHORE HASA
    7e-08   9%  2cxhA  [x.x.x] PROBABLE BRIX-DOMAIN RIBOSOMAL BIOGENESIS
    2e-05  16%  3ea4A  [x.x.x] ACETOLACTATE SYNTHASE, CHLOROPLASTIC
    5e-04  15%  2c31A  [x.x.x] OXALYL-COA DECARBOXYLASE
:967

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ay0A           ----------------------------------------------------------------------
2e6kA           ----------------------------------------------------------------------
2bfcB           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
3cznA           ----------------------------------------------------------------------
3a17E           ----------------------------------------------------------------------
3bvuA           ----------------------------------------------------------------------
3cx3A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
2beuA           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
3cx3B           ----------------------------------------------------------------------
3a17A           ----------------------------------------------------------------------
3a15A           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
3bvgA           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
1dkhA           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
3bvmA           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3a18D           ----------------------------------------------------------------------
2aq3D           ----------------------------------------------------------------------
2d81A           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
2d80A           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
3ddrC           ----------------------------------------------------------------------
2cxhA           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDE
1ay0A           ----------------------------------------------------------------------
2e6kA           ----------------------------------------------------------------------
2bfcB           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
3cznA           ----------------------------------------------------------------------
3a17E           ----------------------------------------------------------------------
3bvuA           ----------------------------------------------------------------------
3cx3A           ----------------------------------------------------------------------
2bp7A           --------------------------------------------------------------------NE
2beuA           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
3cx3B           ----------------------------------------------------------------------
3a17A           ----------------------------------------------------------------------
3a15A           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
3bvgA           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
1dkhA           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
3bvmA           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3a18D           ----------------------------------------------------------------------
2aq3D           ----------------------------------------------------------------------
2d81A           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
2d80A           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
3ddrC           ----------------------------------------------------------------------
2cxhA           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LHPEHYGFKKENYDEKIYLDGVINKEHSSIKEILNFLNKTYCGPIGYEYMHISNPTERKWLRDRIEQDEN
1ay0A           ----------------------------------------------------------------------
2e6kA           ----------------------------------------------------------------------
2bfcB           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
3cznA           ----------------------------------------------------------------------
3a17E           ----------------------------------------------------------------------
3bvuA           ----------------------------------------------------------------------
3cx3A           ----------------------------------------------------------------------
2bp7A           YAPLRLHVPEPTGRPGCDFSYLRLNDAGQARKPPVDVDAADTADLSYSLVRVLDEQGDAQGPWAED----
2beuA           --------------------------------------AEFID--KLEFIQPNVISGIPIYRVMIINPSE
2bffA           -----------------------------------------------SAEFIDKLEFIQPNVIQIINPSE
3cx3B           ----------------------------------------------------------------------
3a17A           ----------------------------------------------------------------------
3a15A           ----------------------------------------------------------------------
1dtwA           -----------------------------------------------SAEFIDKLEFIQPNVIQIINPSE
2bfdA           ---------------------------------------------GASAEFIDKLEFIQPNVIQIINPSE
2bfeA           --------------------------------------------PGASAEFIDKLEFIQPNVIQIINPSE
3bvgA           ----------------------------------------------------------------------
3dv0A           --------------------------------------------FQFPFAEQLKVAEQFPTFQILNEEGE
1dkhA           ----------------------------------------------------------------------
3dv0E           --------------------------------------------FQFPFAEQLEKVAEQFEEGEVVNEEA
3dvaE           --------------------------------------------FQFPFAEQLKVAEQFPTFQILNEEGE
2bfbA           ---------------------------------------------KLEFIQPNVISGIPIYRVMDRQPSE
2bfcA           -----------------------------------------------SAEFIDKLEFIQPNVIQIINPSE
3bvmA           ----------------------------------------------------------------------
3dvaA           --------------------------------------------FQFPFAEQLEKVAEQFFQIEVVNEEA
3a18D           ----------------------------------------------------------------------
2aq3D           ----------------------------------------------------------------------
2d81A           ----------------------------------------------------------------------
3dv0C           --------------------------------------------FQFPFAEQFPTFQILNEEGEVVNEEA
2d80A           ----------------------------------------------------------------------
3dv0G           --------------------------------------------FQFPFAEQLEKVAEQFGEVVNEEAMP
1cp9B           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
3ddrC           ----------------------------------------------------------------------
2cxhA           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SLQFTKNGKEAILMKLIQAEGFEKFLHKKYVGTKRFGLDGGEGLIPALEQIIKIGGQAKVKEVKIGMSHR
1ay0A           ----------------------------------------------------HPGAPLGMAPAAHVLWSQ
2e6kA           ------------LETLSVNAI--RFLAIDAVEKARSGHPGPGPLAYLLFREVRHNPLDP------DWPDR
2bfcB           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
3cznA           ----------------------------------------------------------------------
3a17E           ----------------------------------------------------------------------
3bvuA           ----------------------------------------------------------------------
3cx3A           ----------------------------------------------------------------------
2bp7A           ---IDPQILRQGMRAMLKTRIFDSRMVVAQRQ----KKMSFYMQSLGEEAIGSGQALALNRTDMCFPTYR
2beuA           DPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSA----AALDNTDLVFGQYR
2bffA           DPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSA----AALDNTDLVFGQYR
3cx3B           ----------------------------------------------------------------------
3a17A           ----------------------------------------------------------------------
3a15A           ----------------------------------------------------------------------
1dtwA           DPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSA----AALDNTDLVFGQYR
2bfdA           DPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSA----AALDNTDLVFGQAR
2bfeA           DPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSA----AALDNTDLVFGAAR
3bvgA           ----------------------------------------------------------------------
3dv0A           VVELSDEQLKELMRRMVYTRILDQRSISLNRQGRYAPTAGQEASQIASHFALE-------KEDFILPGYR
1dkhA           -----------------------------------------------------------------DSSFG
3dv0E           MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPTAGQEASQIASH----FALEKEDFILPGYR
3dvaE           VVELSDEQLKELMRRMVYTRILDQRSISLNRQGRYAPTAGQEASQIASHFALE-------KEDFILPGYR
2bfbA           DPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSA----AALDNTDLVFGAYR
2bfcA           DPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSA----AALDNTDLVFGQFR
3bvmA           ----------------------------------------------------------------------
3dvaA           MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRYAPTAGQEASQIASHFALE-------KEDFILPGYR
3a18D           ----------------------------------------------------------------------
2aq3D           ----------------------------------------------------------------------
2d81A           ----------------------------------------------------------------------
3dv0C           MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPTAGQEASQIASHFALE----KEDFILPGYR
2d80A           ----------------------------------------------------------------------
3dv0G           --ELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAGQEASQIASHFALE-------KEDFILPGYR
1cp9B           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
3ddrC           ----------------------------------------------------------------------
2cxhA           -----------------------------------------------SEELAREAIIRGADRIVVVGERR
3ea4A           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GRLNVLANVLQKSYKRIFNEFAGDIQTSGEEGAGDVKYHLGASSNREFDGNSVHVSLTDNPSHLEAVNPV
1ay0A           MRMNPTNPDWINRDRFVLSNGAVALLYSMLHLTGDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISN
2e6kA           DRFVLSAGHGSLLYAVLHLTGYDLPLEELKSFRQWGSKTPGHPERGHTPGVEV------TTGPLGQGIST
2bfcB           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
3cznA           ----------------------------------------------------------------------
3a17E           ----------------------------------------------------------------------
3bvuA           ----------------------------------------------------------------------
3cx3A           ----------------------------------------------------------------------
2bp7A           QQSILMAR--DVSLVEMICQLLSNERDPLK------------GRQLPIMYSVREAGFFTISGNLATQFVQ
2beuA           EAGVLMYR--DYPLELFMAQCYG--NISDLGKGRQMPVHYGC----------------KERHFVTISSPL
2bffA           EAGVLMYR--DYPLELFMAQCYGN--ISDLGKGRQMPVHYGCKERHFVT----------ISSPLATQIPQ
3cx3B           ----------------------------------------------------------------------
3a17A           ----------------------------------------------------------------------
3a15A           ----------------------------------------------------------------------
1dtwA           EAGVLMYR--DYPLELFMAQCYGN--ISDLGKGRQMPVHYGC----------------KERHFVTISSPL
2bfdA           EAGVLMYR--DYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISS------------PLATQIPQ
2bfeA           EAGVLMYR--DYPLELFMAQCYGN--ISDLGKGRQMPVHYGCKERHFVTISS----------PLATQIPQ
3bvgA           ----------------------------------------------------------------------
3dv0A           DVPQIIWH--GLPLYQAFLFSRGH--FHGNQIPEGVNVLPP--------------QIIIGAQYIQAA---
1dkhA           G--YSIHDYLGQ-WASTFGDVNHTNGNVTDANSGGFQYAISSTANQFVAGGNLTYTLFNEPAHTLY----
3dv0E           DVPQIIWH--GLPLYQAFLFSRG--HFHGNQIPEGVNVLPP--------------QIIIGAQYIQAAGVA
3dvaE           DVPQIIWH--GLPLYQAFLFSRG--HFHGNQIPEGVNVLPP--------------QIIIGAQYIQAAGVA
2bfbA           EAGVLMYR--DYPLELFMAQCYGN--ISDLGKGRQMPVHYGCKERHFVTISS----------PLATQIPQ
2bfcA           EAGVLMYR--DYPLELFMAQCYGN--ISDLGKGRQMPVHYGCKERHFVTI----------SSPLATQIPQ
3bvmA           ----------------------------------------------------------------------
3dvaA           DVPQIIWH--GLPLYQAFLFSRGHFHGNQ--IPEGVNVLPP--------------QIIIGAQYIQAAGVA
3a18D           ----------------------------------------------------------------------
2aq3D           ----------------------------------------------------------------------
2d81A           ----------------------------------------------------------------------
3dv0C           DVPQIIWH--GLPLYQAFLFSRGH--FHGNQIPEGVNVLPP--------------QIIIGAQYIQAAGVA
2d80A           ----------------------------------------------------------------------
3dv0G           DVPQIIWH--GLPLYQAFLFSRGHFHGNQ--IPEGVNVLPP--------------QIIIGAQYIQAAG-V
1cp9B           ----------------------------------------------------------------------
1b2vA           -----IHDYLGQ-WASTFGDVNHNVTDANSGGGGSLQYAISSTANQFVAGGNLTYTLFNEPAHTLY----
3ddrC           -------------------QWASTFGNSGGFYGGSLQYAISSTANQFVAGGNLTYTLFNEPAHTLY----
2cxhA           GNPGIIRVYAVEGPERPDNIVSFIV--------KGVSLSRERRWGLPSLRGGEVLVARPLDSGVAVEFAD
3ea4A           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLGQTRAKQFFHKDKERNKVIPILIHGDAAFAGQGVVTECFAMSGLPGHNTGGTIHIIVNNQIGFTTSPR
1ay0A           AVGMAMAQAYNKPGFTLSDNYTYVFLGDGCLQEGISSEA---SSLAGHLKLGNLIAIYDDNKITIDG-AT
2e6kA           AVGRKLAAEFNRPGHVVVDHYTYVLASDGDLEGVSGE----AASLAGHWGLSKLIVFWDDNRISIDGPTD
2bfcB           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
3cznA           ----------------------------------------------------------------------
3a17E           ----------------------------------------------------------------------
3bvuA           ----------------------------------------------------------------------
3cx3A           --------------------------------GKGKIVTSFYPIYAVKEVSGDLNDVRIQSSSGIHS---
2bp7A           AVGWAMASAIKGDTK-----IASAWIGDGATA-ESDFHTALTFAH---VYRAPVILNVVNNQWISTFQAI
2beuA           ATQIPQAAAYAAKRANANRVV-ICYFGEGAAS-EGDAHAGFNFAATLECPI---IFFCRNNGYAISTPTS
2bffA           AVGAAYAA----KRANANRVV-ICYFGEGAAS-EGDAHAGFNFAA---TLECPIIFFCRNNGYAISTPTS
3cx3B           ------------------------------------IVTSFYPIYAVKEVSGDLNDVRIQSSSGIHSF--
3a17A           ----------------------------------------------------------------------
3a15A           ----------------------------------------------------------------------
1dtwA           QIPQAVGAAYAAKRANANRVV-ICYFGEGAAS-EGDAHAGFNFAATLECPI---IFFCRNNGYAISTPTS
2bfdA           AVGAAYAA----KRANANRVV-ICYFGEGAAS-EGDAHAGFNFAATLECPI---IFFCRNNGYAISTPTS
2bfeA           AVGAAYAA----KRANANRVV-ICYFGEGAAS-EGDAHAGFNFAATLECPI---IFFCRNNGYAISTPTS
3bvgA           ----------------------------------------------------------------------
3dv0A           --GVALGLKMRGKKA-----VAITYTGDGGTS-QGDFYEGINFAG---AFKAPAIFVVQNNRFAISTPVE
1dkhA           --GQLDSLSFGDGLSGGD-------TSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGAL
3dv0E           L-----GLKMRGKKA-----VAITYTGDGGTS-QGDFYEGINFAG---AFKAPAIFVVQNNRFAISTPVE
3dvaE           L-----GLKMRGKKA-----VAITYTGDGGTS-QGDFYEGINFAG---AFKAPAIFVVQNNRFAASTPVE
2bfbA           AVGAAYAA----KRANANRVV-ICYFGEGAAS-EGDAHAGFNFAATLECPI---IFFCRNNGYAISTPTS
2bfcA           AVGAAYAA----KRANANRVV-ICYFGEGAAS-EGDAHAGFNFAATLECPI---IFFCRNNGYAISTPTS
3bvmA           ----------------------------------------------------------------------
3dvaA           L-----GLKMRGKKA-----VAITYTGDGGTS-QGDFYEGINFAG---AFKAPAIFVVQNNRFAASTPVE
3a18D           ----------------------------------------------------------------------
2aq3D           ----------------------------------------------------------------------
2d81A           ----------------------------------------------------------------------
3dv0C           L-----GLKMRGKKA-----VAITYTGDGGTS-QGDFYEGINFAG---AFKAPAIFVVQNNRFAISTPVE
2d80A           ----------------------------------------------------------------------
3dv0G           ALGLKMRGK---------KAVAITYTGDGGTS-QGDFYEGINFAG---AFKAPAIFVVQNNRFAISTPVE
1cp9B           -------------------------FNPAYTYGIGLHGAGFNIVGNTPFAYPA-ILFGHNGHVSWGSTAG
1b2vA           --GQLDSLSFGDGLSGGD-------TSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGAL
3ddrC           --GQLDSLSFGDGLSGGD-------TSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGAL
2cxhA           AFVIAFHLKPPEAAGYVEAVIESLDARTVAV---------------------------------------
3ea4A           ----------------NPDAIVVDIDGDGSF---IMNVQELATIRVENLPV---KVLLLNNQHLGMVMQW
2c31A           -MGIGMGYCVAAAAVTGKPVI--AVEGDSAF---GFSGMELETICRYNLPV---TVIIMNNGGIYKGGVI


                         .         .         +         .         .         .         .:490
query           FARSSPYPSDVAKMVDAPILHVNGDDPEAVVYATRIATEFRLKFNRDVVVDLICYRRFGHNEGDEPSFTQ
1ay0A           SISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKL-SKDKPTLIKMTTTIGYGSLHAGSHSVAG
2e6kA           LAFTEDVLARYRAYGWQTLRVEDVNDLEALRKAIKLA----KLDERPTLIAVRSHIGFGSPQDSAKAHGE
2bfcB           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
3cznA           --------------VDVQMLELSFKDIDGGVWKQGWNIKYDPKLKVFVVPDPGWIQTFEEYYQHDTKHIL
3a17E           ----------------------------------------------------------------------
3bvuA           ----------------------------------------------------------------------
3cx3A           ---FEPSANDIAAIYDADVFVYHSHTLESWA--GSLDPNLKKSKVKVLEASEGTLERVPGTLYDPHTWLD
2bp7A           AGGESTTFAGRGVGCGIASLRVDGNDFVAVYAASRWAAERARRGLGPSLIEWVTYRAGPHSTSDDPSKYR
2beuA           EQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYR
2bffA           EQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYR
3cx3B           ----EPSANDIAAIYDADVFVYHSHTLESWA--GSLDPNLKKSKVKVLEASEGTLERVPGTLYDPHTWLD
3a17A           ----------------------------------------------------------------------
3a15A           ----------------------------------------------------------------------
1dtwA           EQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSA--
2bfdA           EQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGSTDHPISRLRHY
2bfeA           EQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHSTDHPISRLRH
3bvgA           ----------------------------------------------------------------------
3dv0A           KQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHENEWA-----
1dkhA           ETALNGILDDYGLSVNST-----FDQVAAA----------------------------------------
3dv0E           KQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYEWAKKDPLVRFRK
3dvaE           KQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSGDNEWAK
2bfbA           EQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRDHPISRLRHYLLSQ
2bfcA           EQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIDHPISRLRHYLLS
3bvmA           ----------------------------------------------------------------------
3dvaA           KQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHMSGDDPTRYR
3a18D           ----------------------------------------------------------------------
2aq3D           ----------------------------------------------------------------------
2d81A           ----------------------------------------------------------------------
3dv0C           KQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTENEWAKKDP
2d80A           ----------------------------------------------------------------------
3dv0G           KQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTDPTNEWA--
1cp9B           FGDGVDIFAEQVSPEDPNSYLHQGQWKKMLSRQETLN----VKGEQPITFEIYRTVHGNVVKRDKTTHTA
1b2vA           ETALNGILDDYGLSVNST-----FDQVAAA----------------------------------------
3ddrC           ETALNGILDDYGLSVNSTF-----DQVAAA----------------------------------------
2cxhA           ----------------------------------------------------------------------
3ea4A           EDRFYKANRAHTFLGDPAQEDEIFPNMLLFAAACGIAIQTMLDTPGPYLLDVICPHQEHVLPMIPS----
2c31A           SCTRLTRG-RYDMMMEAKGYVANTPAELKAALEEAVASG------KPCLINAMIDPDAG-----------


                         *         .         .         .         .         +         .:560
query           PLMYKKIRSHPTPVEMYGKKLVNENTLSESELSKFKTDFKNLLDDQYKNAKDYKPKIEWYEGTWSRYKPE
1ay0A           --APLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKL----------FSEYQKK
2e6kA           PLGPEAVEATRRNLGWYPPFVVPEEVYRH------------DREKGRAWQEAWEKALEAYA----RAYPD
2bfcB           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
3cznA           SNALRHLHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQL----------EFVTGGWVMPDEA
3a17E           ----------------------------------------------------------------------
3bvuA           ----------------------------------------------------------------------
3cx3A           PEKAGEE------AQIIADKLSEVDSEHKETYQKNAQAFIKKAQELTKKFQPKFEKAFSYLAKRFGLNQL
2bp7A           PADDWSHFPLGDPIARLKQHLIKIGHWSEEEHQATTAEFEAAVIAAQKEAEQYGTLAGHIPSAAS-----
2beuA           NYWDKQD----HPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQARKPKPNPLLFSDVYQEMPA-
2bffA           EVGYWDKQDH--PISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERPKPNPLLFSDVYQEMPAQ
3cx3B           PEKAGEE------AQIIADKLSEVDSEHKETYQKNAQAFIKKAQEKFQPKFEKATQKTFQHTAFSYLAKR
3a17A           ----------------------------------------------------------------------
3a15A           ----------------------------------------------------------------------
1dtwA           ---------YRHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNLLFSDVYQEM-PA
2bfdA           LLSQGWW--------------------DEEQEKAWRKQSRRKVMEAFEQAEPKPNPNLLFSDVYQEMP--
2bfeA           YLLSQGWWDEE-------------------QEKAWRKQSRRKVMEAFEQAERKPKPNLLFSDVYQEMPAQ
3bvgA           -------------------------------------------------QPDPMPDDSEFTGTMGNMKYL
3dv0A           ---------KKDPLVRFRKFLEAKGLWSEEEENNVIEQAKEEIKEAIKKAETPKQKVDLISIMFEELPFN
1dkhA           ----------------------------------------------------------------------
3dv0E           FLEAKGLWSEEEENNVIEQAKEEIKEAIKKADETPKQKVTDLISIMFEELPFNLKQYEIY----------
3dvaE           KDPLVRFRKFLEAKGLWSEEEENNEAIKKADETP-KQKVTDLISIMFEELPFNLKEYEIYKEKESK----
2bfbA           GWWDEEQEKAWRKRRKVMEAFEQAERKPKPNPNLLFSDYQEMPA---QLRKQQESLARHLQTYGEHY-PL
2bfcA           QGWWDEEQEKAWRKQSRRKVMEAFEQAERKP----KPNPNLLFSDVY---QEMPAQLRKQQESLARHLQT
3bvmA           -----------------------------------------------EFTGTMGNMKYLYDDHYVSATK-
3dvaA           SKELENEWAKKDPLVRFRKFLEAKGLWSEEEENNVIEQAKEEIKEAIKKAETPKQKVDLISIMFEELPFN
3a18D           ----------------------------------------------------------------------
2aq3D           ------------------------------------------MPDDLHKSSEFTGTMYLYDDHYVSATKV
2d81A           ----------------------------------------------------------------------
3dv0C           LVRFRKFLEAKGLWSEEEENNVIEQAKEEKADETPKQKVTDLISIMFEELPFNLKQYEIYKEKESK----
2d80A           ----------------------------------------------------------------------
3dv0G           ---------KKDPLVRFRKFLEAKGLWSEEEENNVIEQAKEEIKEAIKKAETPKQKVDLISIMFEELPFN
1cp9B           YSKARAWDGKE-LTSLMAWVKQGQAQNWQDQAQNQALTINWYYADKDGNIGYVHTHYPDRQINHDPRLPV
1b2vA           ----------------------------------------------------------------------
3ddrC           ----------------------------------------------------------------------
2cxhA           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KGKDKRGVSGYDQQKLLEISEKINATPEKLKLHKTIVKILDARKASVSNGKGIDWSTAEALAFGSLLEEG
1ay0A           FPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWK
2e6kA           LHQELRRLRG-----------ELPPLPEEPP----------------SFDKPIATRAASGRAL-NLLAPR
2bfcB           -----------------------------------------------GQTQKMNLFQSVTSALDNSLAKD
1dtwB           -------------------------------------------------TQKMNLFQSVTSALDNSLAKD
2bp7B           -------------------------------------------------TTTMTMIQALRSAMDVMLERD
3cznA           NS--------HWRNVLLQLTEGQTWLK-----QFMNVTPTASWAIAPFGHSPTMPYILQKSGFKNMLIQR
3a17E           ---------------------------------------------------------GEHLQCPRTLTRR
3bvuA           -----------------------------------------------------MPYILQKSGFKNMLIQR
3cx3A           GIAGISPEQEPSPRQLTEIQEFVKTYKVKTIFTESNATLVKSTGVGLKTLNPLESDPQNDKTYLENLEEN
2bp7A           ----------------------------------------------------------------------
2beuA           ----------QLRKQQESLARHLQTYGEHYPLDH------------------------------------
2bffA           L-----------RKQQESLARHLQTYGEHYPLDH------------------------------------
3cx3B           FGLNQLGIAGEIQEFVKTYKVKTIFTESNASVAETLVKSTGVGLKTL----NPLESDPNDKTYLENLEEN
3a17A           ----------------------------------------------------------------------
3a15A           ----------------------------------------------------------------------
1dtwA           QLRKQQE----------SLARHLQTYGEHYPLDH------------------------------------
2bfdA           ---------AQLRKQQESLARHLQTYGEHYPLDH------------------------------------
2bfeA           -----------LRKQQESLARHLQTYGEHYPLDH------------------------------------
3bvgA           YDDHYVKVKSVDKFLAHDLIYNISDKKLKNYDK-VKTELLNEDLAKKYKDEVVDVYGSNYCYFGKTCMYG
3dv0A           LKEQ------------------------------------------------------------------
1dkhA           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
2bfbA           DHFDK-----------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
3bvmA           -------VKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKY-KDEVVDVNYYVNCYFGKTCMYG
3dvaA           LKEQ------------------------------------------------------------------
3a18D           ----------------------------------------------------------------------
2aq3D           KSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVYGSNYYVNCYFSSKDKVTGGKTCMYG
2d81A           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
2d80A           ---------------------------------------------------GGPYDCARNQYYTSCMY--
3dv0G           LKQYEIYKEK------------------------------------------------------------
1cp9B           SGTGEWDWKGIQPFANN-----------------------------------------------------
1b2vA           ----------------------------------------------------------------------
3ddrC           ----------------------------------------------------------------------
2cxhA           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           YPVRLVGQDSGRGTFSQRHSVLRNQEDNSRYIPLNNISKNQMRYEIVDSFLSELAVLGFEYGYSLVEPNT
1ay0A           EALDFQPPSSGSGNYSGRY---------------------------IRYGIREHAMGAIMNGISAFGA--
2e6kA           LPELLGG--SADLTPSNNT-----------KAEGEDFSRANPLGRYLHFGVREHAGAILNGLNLHGGYRA
2bfcB           PTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVF---------------NTPLCEQGIVGF--GIGIAVTGA
1dtwB           PTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVF---------------NTPLCEQGIVGFGIGIAVT--GA
2bp7B           DNVVVYGQDVGYFGGVFRCT--------------EGLQTKYGKSRVFDAPISESGIVGTAVGMGAYGL--
3cznA           THYSVKKELAQQRQLEFLWRQIWDNKGDTALFTHMM--PFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLS
3a17E           VPD---TYTPPFPMWVGRADDAMGYLGVQFRDEDQRPAALQAMRDIVAGFDLPDGPAHHDLTHHIDNQGY
3bvuA           THYSVKKELAQQRQLEFLWRQIWDNKGD--TALFTHMMPFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLS
3cx3A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
2beuA           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
3cx3B           SIL-------------------------------------------------------------------
3a17A           ---------------------------------------------VAGFDLPDGPAHHDLTHHIDNQGYE
3a15A           ------------------------------WVGRADDALQQVVMGYLGVQFRDEDQAMRDIVAGFDLPDG
1dtwA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
3bvgA           GITKHEGNHFDNGNLNKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENN
3dv0A           ----------------------------------------------------------------------
1dkhA           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
3bvmA           GITKHEGNHFDNGNLNKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYKFIENNG
3dvaA           ----------------------------------------------------------------------
3a18D           ----------------------------------------QAMRDIVAGFDLPDGPAHHDLTHHIDNQGY
2aq3D           GITKHEGNHFDNGNLNKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYKFIENNG
2d81A           -ARNQYYTSCMYNGYPSITTPTANMKSWSGNQIASVANLGQRKIYMWTGSSDTT-----------VGPNV
3dv0C           ----------------------------------------------------------------------
2d80A           -----------NGYPSITTPTAMKSWSGNQIASVANLGQRK--------------IYMWTGSSTTVGPNV
3dv0G           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
3ddrC           ----------------------------------------------------------------------
2cxhA           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LTIWEAQFGDFANGAQVVIDQFIASGERKWTRASGLVMLLPHGYEGQGPEHSSARLERFLQLCANDNLQV
1ay0A           --NYKPYGGTFLNFVSYAAGAVRLSALSGH-PVIWVATHDSIGVGEDGPTHQPIETLAH--FRSLPNIQV
2e6kA           YGGTFLVFSDY----RPAIRLAALGVPTVFVFTHDSIALGEDGPTHQPVEHLSL---------RAPNLFV
2bfcB           TAIAEIQFADYIFPAFDQIVNEAAKYRYRSFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHC--PGIKV
1dtwB           TAIAEIQFADYIFPAFDQIVNEAAKYRYRSFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHC--PGIKV
2bp7B           RPVVEIQFADYFYPAQIVSEMARLRYRSAGEFIAPLTLRMPCGGGIYGGQTHSQSPEAMFTQV--CGLRT
3cznA           CPWKVPPRTISDQNVAARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRLFEHIQAHFNVQ
3a17E           ENLIVVGYWKDVSS----QHRWSTSTPIASWWESEDRL---SDGLGFFREIVAPRAEQFETLYAFQEDLP
3bvuA           CPWKVPPRTISDQNVAARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDYERLFEHIQAHFNVQ
3cx3A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
2beuA           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
3cx3B           ----------------------------------------------------------------------
3a17A           NLIVVGYWKDVSSQ-----HRWSTSTPIASWWE---SEDRLSDGLGFFREIVAPRAEQFETLYAFQEDLP
3a15A           PAHHDLTHHIDNQGYENLIVVGYWKDVSSQHRWSTSTPIA-SWWESEDRLSDGLGFFREIVAPRAEQFET
1dtwA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
3bvgA           GNTFWYDMMPAPGFDQSKYLMMVDSKSVKI----------------------------------------
3dv0A           ----------------------------------------------------------------------
1dkhA           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
3bvmA           NTFWYDMMNKTVDSKSVKIEVHL-----------------------------------------------
3dvaA           ----------------------------------------------------------------------
3a18D           ENLIVVGYWKDVSS----QHRWSTSTPIASWWESEDRL---SDGLGFFREIVAPRAEQFETLYAFQEDLP
2aq3D           NTFWY----DMMPAPGDKFDQ-------------------------------------------------
2d81A           MNQLKAQLGNFDNSANVSYVTT-----------TGAVHTFPTDFNGAGDNSCSLSTSPYISNCNYDGAGA
3dv0C           ----------------------------------------------------------------------
2d80A           MNQLKAQLGNFDNSANVSYVTTT-----------GAVHTFPTDFNGAGDNSCSLSTSPYISNCNY-----
3dv0G           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
3ddrC           ----------------------------------------------------------------------
2cxhA           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LNCTTPANYYHALRRQMHREFRKPLIIMTPKSLLRNKHCVSNIEDFGKDNFFHRILWDHALDEENGFIKL
1ay0A           WRPADGNEVSAAY-KNSLESKHTPSIIALSRQNLPQLEGSSIESAS----------------KGGYVLQD
2e6kA           IRPADAYETFYAWLVALRRKEGPTALVLT-----RQAVPLLSPEKARGLLRGGYVLEDVE----------
2bfcB           VIPRSPFQAKGLLLSCI--EDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGS----------
1dtwB           VIPRSPFQAKGLLLSCIE--DKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGS----------
2bp7B           VMPSNPYDAKGLLIASIEC--DDPVIFLEPKRLYNGPFDGHHDRPVTPWSKHPHSAVPDGYYTVPLDKAA
3cznA           AQFGTLQEYFDAVHQAERAGQAEFPTLSGDFFTYADRSDNYWSGY-----YTSRPYHKRMDRVLMHYVRA
3a17E           GVGAVMDGISGEINEHGYWGSMRERFPISQTDWMQASGELRVIAGDPAVGGRVVVRGHDNIALIRSGQDW
3bvuA           AQFGTLQEYFDAVHQAERAGQAEFPTLSGDFFTYA-----DRSDNYWSGYYTSRPYHKRMDRVLMHYVRA
3cx3A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
2beuA           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
3cx3B           ----------------------------------------------------------------------
3a17A           GVGAVMDGISGEINEHGYWGSMRERFPISQTDWMQASGELRVIAGDPAVGGRVVVRGHDNIALIRSGQDW
3a15A           LYAFQEDGISGEINEHGYWGSMRERFPISQTDWMQASGELRVIAGDPAVGGRVVVRGHDNIALIRSGDWA
1dtwA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
3bvgA           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
1dkhA           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
3bvmA           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3a18D           GVGAVMDGISGEINEHGYWGSMRERFPISQTDWMQASGELRVIAGDPAVGGRVVVRGHDNIALIRSGQDA
2aq3D           ----------------------------------------------------------------------
2d81A           ALKWIYGSLNARNTGTLSGSVLSFAQSGSYGANGMDTTGYLYVPQSCASGATV-----------------
3dv0C           ----------------------------------------------------------------------
2d80A           -------DGAGAALKWIYGSLNARNTGTLSGSVLSFAQSGSYGANGMDTTGYLYVPQSCA----------
3dv0G           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
3ddrC           ----------------------------------------------------------------------
2cxhA           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           KESSKIKKVILCSGKVYFDLLEAREKLKKDDVVLYRIEQLYPFPVKSLVREIKKYAKNANFYWCQEEPKN
1ay0A           VANPDI--ILVATGSEVSLSVEAAKTLAAKKARVVSLPDFFTFDKQPLEYRLSVL-PDNVPIMSVEVLAT
2e6kA           ----EPQGVLVATGSEVHLALRAQALLREKRVRVVSLPSFELFA-AQPEAYRKEVLPPGLPVVAVEAGAS
2bfcB           ------DVTLVAWGTQVHVIREVASMAKEKSCEVIDLRTIIPWDVDTICKSVIKTGR---LLISHEAPLT
1dtwB           ------DVTLVAWGTQVHVIREVASMAKEKSCEVIDLRTIIPWDVDTICKSVIKTGR---LLISHEAPLT
2bp7B           ITRPGNDVSVLTYGTTVYVAQVAAEES-GVDAEVIDLRSLWPLDLDTIVESVKKTGR---CVVVHEATRT
3cznA           AE-MLSAWHSWDGMARIEERLEQARRE------LSLFQHHDGITGTAKTHVVVDYEQRMQEALKACQMVM
3a17E           ADAEA-DERSLYLDEILPTLQSGMDFLRDNAVGCYSNRFVRNIDIDGNFLDLSYNIG---HWASLDQLER
3bvuA           AE-MLSAWHSWDGMARIEERLEQARR--------------------------------------------
3cx3A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
2beuA           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
3cx3B           ----------------------------------------------------------------------
3a17A           A-DAEADERSLYLDEILPTLQSGMDFLRDNAVGCYSNRFVRNIDIDGNFLDLSYN-IGHWASLDQLERWS
3a15A           DAEADE--RSLYLDEILPTLQSGMDFLRDNAVGCYSNRFVRNIDIDGNFLDLSYN-IGHWASLDQLERWS
1dtwA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
3bvgA           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
1dkhA           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
3bvmA           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3a18D           DAEADE--RSLYLDEILPTLQSGMDFLRDNAVGCYSNRFVRNIDIDGNFLDLSYNIG---HWASLDQLER
2aq3D           ----------------------------------------------------------------------
2d81A           -----CSLHVALHGCLQSYSSIGSRFIQNTGYN--KWADTNNMIILYPQAIPDYTIHAIWNGGVLSNPNG
3dv0C           ----------------------------------------------------------------------
2d80A           SGATVCSLHVALHGCLQSY--SSIGSRFIQNTGYNKWADTNNMIILYPQAIPDYTIHAIWNGGVLSNPNG
3dv0G           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
3ddrC           ----------------------------------------------------------------------
2cxhA           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           MGAWFSVRDYIQWTLETINANNTGISYIGRSPDASPATGYAKRHLAQQQEIIKKVFE
1ay0A           TCWGKYAHQSFIDRFGASGKAPEVFKFFGFTP-EGVAERAQKTIAFYKGDKLISPLK
2e6kA           LGWERYAHKVV----------------------------------------------
2bfcB           GGFASEISSTVQE--ECFLNLEAPISRVCGYDTPFPHIFEPFYIP-DKWKCYDALRK
1dtwB           GGFASEISSTVQE--ECFLNLEAPISRVCGYDTPFPHIFEPFYIP-DKWKCYDALRK
2bp7B           CGFGAELVSLVQEHC--FHHLEAPIERVTG-WDTPYPHAQEWAYFPGPSRVGAALKK
3cznA           QQSVYRLLTKPSI--------------------------------------------
3a17E           WSESHPTHLRIFTTF-FRVAAGLSKLRLYHEVSVFDAADQLYEYINCHPGT------
3bvuA           ---------------------------------------------------------
3cx3A           ---------------------------------------------------------
2bp7A           ---------------------------------------------------------
2beuA           ---------------------------------------------------------
2bffA           ---------------------------------------------------------
3cx3B           ---------------------------------------------------------
3a17A           ESHPTHLRIFTTFFRVAAGLSKLRLYHEVSVFDAADQLYEYINCHPGTGMLRDAV--
3a15A           ESHPTHLRIFTTFFRVAAGLSKLRLYHEVSV---FDAADQLYEYINCHPGT------
1dtwA           ---------------------------------------------------------
2bfdA           ---------------------------------------------------------
2bfeA           ---------------------------------------------------------
3bvgA           ---------------------------------------------------------
3dv0A           ---------------------------------------------------------
1dkhA           ---------------------------------------------------------
3dv0E           ---------------------------------------------------------
3dvaE           ---------------------------------------------------------
2bfbA           ---------------------------------------------------------
2bfcA           ---------------------------------------------------------
3bvmA           ---------------------------------------------------------
3dvaA           ---------------------------------------------------------
3a18D           WSESHPTHLRIFTTF-FRVAAGLSKLRLYHEVSVFDAADQLYEYINCHPG-------
2aq3D           ---------------------------------------------------------
2d81A           CWDWVGWYGSNADQIGGVQM-------------------------------------
3dv0C           ---------------------------------------------------------
2d80A           CWDWVGWYGSN----------------------------------------------
3dv0G           ---------------------------------------------------------
1cp9B           ---------------------------------------------------------
1b2vA           ---------------------------------------------------------
3ddrC           ---------------------------------------------------------
2cxhA           ---------------------------------------------------------
3ea4A           ---------------------------------------------------------
2c31A           ---------------------------------------------------------