[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21098.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ahuA.bssp"
#ERROR : Can't open dsspfile "1e8gA.bssp"
#ERROR : Can't open dsspfile "1dznA.bssp"
#ERROR : Can't open dsspfile "1e8fA.bssp"
#ERROR : Can't open dsspfile "2bvfA.bssp"
#ERROR : Can't open dsspfile "1e0yA.bssp"
#ERROR : Can't open dsspfile "3c0pA.bssp"
#ERROR : Can't open dsspfile "3e0tA.bssp"
#ERROR : Can't open dsspfile "3d2hA.bssp"
#ERROR : Can't open dsspfile "3bw7A.bssp"
#ERROR : Can't open dsspfile "3d2jA.bssp"
#ERROR : Can't open dsspfile "3dq0A.bssp"
#ERROR : Can't open dsspfile "3d2dA.bssp"
#ERROR : Can't open dsspfile "2e3tA.bssp"
#ERROR : Can't open dsspfile "2e3tB.bssp"
#ERROR : Can't open dsspfile "2e1qA.bssp"
#ERROR : Can't open dsspfile "2ckjC.bssp"
#ERROR : Can't open dsspfile "2ckjD.bssp"
#ERROR : Can't open dsspfile "2ckjA.bssp"
#ERROR : Can't open dsspfile "3bdjA.bssp"
#ERROR : Can't open dsspfile "2e67A.bssp"
#ERROR : Can't open dsspfile "3cwcA.bssp"

## Summary of PDB Search
:422
    4e-28  12%  1ahuA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    2e-27  13%  1e8gA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    2e-26  12%  1dznA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    2e-25  12%  1e8fA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    3e-24  12%  2bvfA  [x.x.x] 6-HYDROXY-D-NICOTINE OXIDASE
    6e-22  13%  1e0yA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    2e-21  13%  3c0pA  [x.x.x] CYTOKININ DEHYDROGENASE 1
    8e-21  12%  3e0tA  [x.x.x] GLUCOOLIGOSACCHARIDE OXIDASE
    3e-19  15%  3d2hA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    2e-18  16%  3bw7A  [x.x.x] CYTOKININ DEHYDROGENASE 1
    3e-18  14%  3d2jA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    4e-17  16%  3dq0A  [x.x.x] CYTOKININ DEHYDROGENASE 1
    2e-16  14%  3d2dA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    3e-14  10%  2e3tA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    1e-11   8%  2e3tB  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    1e-08   8%  2e1qA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    2e-08  12%  2ckjC  [x.x.x] XANTHINE OXIDOREDUCTASE
    7e-08   7%  2ckjD  [x.x.x] XANTHINE OXIDOREDUCTASE
    2e-07   7%  2ckjA  [x.x.x] XANTHINE OXIDOREDUCTASE
    3e-07   7%  3bdjA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    1e-04  14%  2e67A  [x.x.x] HYPOTHETICAL PROTEIN TTHB029
    1e-04  11%  3cwcA  [x.x.x] PUTATIVE GLYCERATE KINASE 2
:422

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxYYPEDELQVSNLVQELYKKNQPTEIIGTGSKNFIGNNIQSAKKLSMSKLSGVIEYL
1ahuA           ---------------APRNVADVQSIVGLANKFSFPLWPISIGR-NSGYGGAAPRVSLDMGKNNRVLEVN
1e8gA           ---------------APRNVADVQSIVGLANKFSFPLWPISIGR-NSGYGGAAPRVSLDMGKNNRVLEVN
1dznA           ---------------APRNVADVQSIVGLANKFSFPLWPISIGR-NSGYGGAAPRVSLDMGKNNRVLEVN
1e8fA           ---------------APRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAAPRVSGLDMGNMNRVLEVN
2bvfA           ---------------RCLSAGDVAKSVRYACDNGLEISVRSGGHNPNGYATNDGGIVLDLRLMNS-IHID
1e0yA           ---------------APRNVADVQSIVGLANKFSFPLWPISIGR-NSGYGGAAPRVSLDMGKNNRVLEVN
3c0pA           ---------------YPSSTADLVALLSAANSTPGTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAINVS
3e0tA           ---------------IPRSTEDIAAAVQCGLDAGVQISAKGGGSYGFGGED--GHLMLELDRMYR-VSVD
3d2hA           ---------------LPGSKEELSNTIRCIRKGSWTIRLRSGGHSYEGLSYTSDTPFIDLMNLNR-VSID
3bw7A           ---------------YPSSTADLVALLSAANSTPGTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAINVS
3d2jA           ---------------LPGSKEELSNTIRCIRKGSWTIRLRSGGHSYEGLTSDTPFILIDLMNLNR-VSID
3dq0A           ---------------YPSSTADLVALLSAANSTPGWPYTIGRGHSLMGQAFAPGGVVVNMASLGDAAAPP
3d2dA           ---------------LPGSKEELSNTIRCIRKGSWTIRLRSGGHSYEGLTSDTPFILIDLMNLNR-VSID
2e3tA           --------------------------------------GNTEIGIEMKFKNMLFPLIVCPAWIPELNSVV
2e3tB           --------------------------------------NTEIGI-EMKFKNMLFPLIVCPAWIPELNSVV
2e1qA           --------------IQASTLKELLDLKAQHPDAKLVVGNTEIGI-EMKFKNMLFPMIVCPAWIPELNSVE
2ckjC           ---------------QASTLKELLDLKAQHPDAKLVVGNTEIGI-EMKFKNMLFPMIVCPAWIPELNSVE
2ckjD           --------------IQASTLKELLDLKAQHPDAKLVVGNTEIGI-EMKFKNMLFPMIVCPAWIPELNSVE
2ckjA           --------------IQASTLKELLDLKA--QHPDAKLVVGNTEGIEMKFKNMLFPMIVCPAWIPELNSVE
3bdjA           --------------IQASTLKELLDLKAQHPEAKLVVGNTEIGI-EMKFKNQLFPMIICPAWIPELNAVE
2e67A           ----------------------------------------------------------------------
3cwcA           ---------------ATAIEQGFREIWPDADYLKLPLADGGEGTVEAVEATAGRIVHVEVTGPLGH----


                         .         .         *         .         .         .         .:140
query           PEELYIKVKANTPXXXXXXXXXXXXXXXAFEPIDFGFIENGKSNKGTIAGHLACNFAGSRRFKVGSLRDH
1ahuA           VEGAYCVVEPGVTYHDLHNYLEANNLRDKLWL--------DVPDLGGGSVLGNAVERGVGYTPYGDHWMM
1e8gA           VEGAYCVVEPGVTYHDLHNYLEANNLRDKLWL--------DVPDLGGGSVLGNAVERGVGYTPYGDHWMM
1dznA           VEGAYCVVEPGVTYHDLHNYLEANNLRDKLWL--------DVPSLGGGSVLGNAVERGVGYTPYGDHWMM
1e8fA           VEGAYCVVEPGVTYHDLHNYLEANNLRDKLWL--------DVPDLGGGSVLGNAVERGVGYTPYGDHWMM
2bvfA           TAGSRARIGGGVISGDLVK---------EAAKFGLAAV-TGMHPKVGFCGLALNGGVGFLTPKYGLASDN
1e0yA           VEGAYCVVEPGVTYHDLHNYLEANNLRDKLWL--------DVPSLGGGSVLGNAVERGVGYTPYGDHWMM
3c0pA           ADGRYVDAGGEQVWIDVLR---------ASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISN
3e0tA           DNNVATIQGGARLGYTALE---------LLDQGNRALSHGTAPAVG-VGGHVLGGGYGFATHTHGLTLDW
3d2hA           LESETAWVESGSTLGELYYAITESSSKLGFTAGWCPTVGTG--------GHISGGGFGMMSRKYGLAADN
3bw7A           ADGRYVDAGGEQVWIDVLR---------ASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISN
3d2jA           LESETAWVESGSTLGELYYAITESSSKLGFTAGWCPTVGTG--------GHISGGGFGMMSRKYGLAADN
3dq0A           R----INVSADGRYVDAGGEQVWIDVLRASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISN
3d2dA           LESETAWVESGSTLGELYYAITESSSKLGFTAGWCPTVGTG--------GHISGGGFGMMSRKYGLAADN
2e3tA           HGPEGISFGASCPLSLVESVLAEEIAKLPEQKTEVFRGVME--QLRALAGKQVKSVAGGNIITASPISDL
2e3tB           HGPEGISFGASCPLSLVES---------VLAEEIAKLPEQKTEVFRGVMEQLRALAGKQVKITASPISDL
2e1qA           HGPDGISFGAACPLSIVEKTLVDAVAKLPAQKTEVWFAGKQVKSVASVGGNIITASPISD----LNPVFM
2ckjC           HGPDGISFGAACPLSIVEK---------TLVDAVAKLPAQKTEVFRGVLEQLR-WFAGKQVKSVASV---
2ckjD           HGPDGISFGAACPLSIVEKTLVDAVAKLPAQKTEVWFAGKQVKSVASVGGNIITASPISDLNPV----FM
2ckjA           HGPDGISFGAACPLSIVEKTLVDAVAKLPAQKQLRWFAGKQVKSVASVGGNIITASPISD----LNPVFM
3bdjA           HGPEGISFGAACALSSVEKTLLEAVAKLPTQKTEVEQLRWFAGSVASLGGNIITASPISDLNPVFMASGT
2e67A           ----------------------------------------------------------------------
3cwcA           RVNAFYGLSGDARSAFIEAAASGLEQVPPAQRTTSWGTGELIRHALDAGVEHIIIGIGGSATNDGGAGVQ


                         +         .         .         .         .         *         .:210
query           ILGFRGVNGKGDIIKSGGTVVKNVTGYDLSKLVTGSFGTLVALTEITLKVLPKKKLSNTITIHTDDKKLV
1ahuA           HSGMEVVLANGELLRTMGLKPEDQPWSKIYIDGLFSQSNMGIVTKIGIWLMPNPRGYQSYLITLPKDGDL
1e8gA           HSGMEVVLANGELLRTGMGKPEDQPWSKIAHLGLFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDL
1dznA           HSGMEVVLANGELLRTGGLKPEDQPWSGPYIDGLFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDL
1e8fA           HSGMEVVLANGELLRTGMIAHLFPYGFGPYIDGLFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDL
2bvfA           ILGATLVTATGDVI-----YCSDDERPELFWAVRGAGPNFGVVTEVEVQLYELPRKMLAGFITWAPVSEL
1e0yA           HSGMEVVLANGELLRTMGLKPEDQPWSGPYIDGLFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDL
3c0pA           VLEMDVITGHGEMVT-----CSKQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAF
3e0tA           LIGATVVLADASIV-----HVSETENADLFWALRGGGGGFAIVSEFEFNTFEAPEIITTYQVTTWNRKQH
3d2hA           VVDAILIDANGAIL-----DRQAMGEDVFWAIRGGGGGVWGAIYAWKIKLLPVPEKVTVFRVTKNV----
3bw7A           VLEMDVITGHGEMV-----TCSKQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAF
3d2jA           VVDAILIDANGAIL-----DRQAMGEDVFWAIRGGGGGVWGAIYAWKIKLLPVPEKVTVFRVTKNV----
3dq0A           VLEMDVITGHGEMVTCSKQLNADLF-----DAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTD----
3d2dA           VVDAILIDANGAIL-----DRQAMGEDVFWAIRGGGGGVWGAIYAWKIKLLPVPEKVTVFRVTKNV----
2e3tA           NPVFMASGAKLTLVSRGTRRTVRMDHTFFPGYRKTLLRPEEILLSIEIPYSKEGEFFSAFKQASRREDDI
2e3tB           NPVFMASGAKLTLVSRGTRRTVRMDHTFFPGYRKTLLRPEEILLSIEIPYSKEGEFFSAFKQASRR----
2e1qA           ASGAKLTLVSRGT------RRTVQMDHTFFPGYRKT---LLSPEEILLSIYSREGEYFSAFKQASRREDD
2ckjC           ----------------GGNIITASPISDLNPVFMASGAKLTLVSRGTRRTVQMDHTFFP-----------
2ckjD           ASGAKLTLVSRGTRRTVQMYSREGEYFSAFKQASRREDDIAKVTSGMRVLFKP-----------------
2ckjA           ASGAKLTLVSRGT----------RRTVQMDHTFFPGYRKTL-----------------------------
3bdjA           KLTIVS----RGTRRTVPMDHTFFPSYRKTLLGPEEILL-------------------------------
2e67A           ----------------------------------------------------------------------
3cwcA           ALGARLRDAQGNDIAQGGIGLETLASIDISGLKRLSACHIEVACDVTNPLTGKEGASAVFGPQKGATPEI


                         .         .         .         +         .         .         .:280
query           KNLFDKIXXXXXEVSGAVYIPEEPKDENYDQNKEMVFKFNDLKYKGSFLALRIEGDKIAIDEKIKALTNE
1ahuA           KQAVDIIRPLRLGMALQRSYSSRTEPLSD---EELDKIAKQLNLGRWNFYGALYGPEPIRRVLWETIKDA
1e8gA           KQAVDIIRPLRLGMALQNV---PTIRHILLDAAVLGDKRSQLNLGRWNFYGALYGPEPIRRVLWETIKDA
1dznA           KQAVDIIRPLRLGMALQNVPTSYSSRTEPLSDEELDKIAKQLNLGRWNFYGALYGPEPIRRVLWETIKDA
1e8fA           KQAVDIIRPLRLGMALQNV---PTIRHILLDAAVLGDKRSYSSRTEPLSDEELDKIAKQLNLGRWNFYGA
2bvfA           AGLLTSLLDALNEMADHIYP-------------SVFVGVDENRAPSVTVCVGHLGGLDIAERDIARLSYD
1e0yA           KQAVDIIRPLRLGMALQNV---PTIRHILLDAAVLGDKRSYSSRTEPLSDEELDKIAKQLNLGRWNFYGA
3c0pA           SADQERLPMSYVEGSVFVNQDLANTGFFTDADVARIVALAGERNATTVYSIEATLNYDNATAAAAAVDQE
3e0tA           VAGLKALQDWAQNTMPRELSMRLEINANALNWEGNFFGNAKDLKKILQPIMKKAGGKSTISKLVETDWYG
3d2hA           ----------------------------------------------------------------------
3bw7A           SADQERL---------------------------------------------------------------
3d2jA           ----------------------------------------------------------------------
3dq0A           ----------------------------------------------------------------------
3d2dA           ----------------------------------------------------------------------
2e3tA           AKVTSGMRVLFKPGTIESALKTTPKQLSKSWNEELLQSVCAGLAEELQLAPDAPGGMVEFRRTLFYLTVL
2e3tB           ----------------------------------------------------------------------
2e1qA           IAKVTSGMRVLFKPGTQRQLSKLWKEELLQDVCAGLAEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVL
2ckjC           ----------------------------------------------------------------------
2ckjD           ----------------------------------------------------------------------
2ckjA           ----------------------------------------------------------------------
3bdjA           ----------------------------------------------------------------------
2e67A           ----------------------------------------------------------------------
3cwcA           ERLDTAL---------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LELSKLNTTVLDVHQSTPFWKKINNLELFKQTKNNLLRVVVPPSKGPKLIQFLGNKYKYYIDWCGSLYWI
1ahuA           FSAIPGVKFYFEDTPENSVLRKWIDWLPNGAHLFFSPIAKVSGEDAMMQTKKRCQEAGLDFIGTFTVGMR
1e8gA           FSAIPGVKFYPEDTPENSVLRKWIDWLPNGAHLFFSPIAKVSGEDAMMQYAVTKKRCQFTVGMREMHHIV
1dznA           FSAIPGVKFYFEDTPENSVLRKWIDWLPNGAHLFFSPIAKVSGEDAMMQYAVTKKRCQEAVGMREMHHIV
1e8fA           LYGPEPIRRVLEDTPENSVLRRDKTMQGIPTYDELKWIAKVSGEDAMMQYAVTKKRCQEAVGMREMHHIV
2bvfA           EVVALNAEVGSFEDGMSNLWIDREIAMPNARFAEAINLDKFVSEPASGGSVKLEIEGMPFGNRDAMGVLA
1e0yA           LYGPEPIRRVLEDTPENSVLRKWIDWLPNGAHLFFSPIAKVSGEDAMMQYAVTKKRCQEAVGMREMHHIV
3c0pA           LASVLGTLSYVEGFAFQRDVAYAAFLDRVHGEEVALNKMFVPRSRIADFDRIVGPLIVYPLNSEDVFYAV
3e0tA           QINTYLYGADLNITYNEYFYANSLTAAIQAFVDYKFDNSSVRPGRGWWIQWDFHGGKNSALAAVSYDSIY
3d2hA           ----------------------------------VEYIVAWNQSEQKKKTEFLDWLEKVYEFMKPFVSKN
3bw7A           ----------------------------------------------------------------------
3d2jA           ----------------------------------------------------------------------
3dq0A           ----------------------------------------------------------------------
3d2dA           ----------------------------------------------------------------------
2e3tA           QKLGRADLEDMCGKLDPTFASATLLFQKDPPANVQLFQEVPKDQSEEDMVGRPLPHLAANMQASGEAVYC
2e3tB           ----------------------------------------------------------------------
2e1qA           QKLGQENLEDKCGKLDPTFASATLLFQKDPPADVQLFQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYC
2ckjC           ----------------------------------------------------------------------
2ckjD           ----------------------------------------------------------------------
2ckjA           ----------------------------------------------------------------------
3bdjA           ----------------------------------------------------------------------
2e67A           ----------------------------------------------------------------------
3cwcA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EVQSKKNSKVSDIKKLTKELGGYLTIIKTSDEYDYEETIFTVDDIRLLISEKIKKSFDPKRIFNPGKMYR
1ahuA           IQKRKVQWLMRTLIDDCAANGWGEYRTHFMDQIMETYNWNNSSFLRFN--EVLKNAVDPNGIIAPGKSGV
1e8gA           CIVFNKKDLMRTLIDDCAANGWGEYRTAFMDQIMETYNWNNSSFLRFN--EVLKNAVDPNGIIAPGKSGV
1dznA           CIVFNKKDLMRTLIDDCAANGWGEYRTAFMDQIMETYNWNNSSFLRFN--EVLKNAVDPNGIIAPGKSGV
1e8fA           CIVFNKKDLMRTLIDDCAANGWGEYRTHFMDQIMETYNWNNSSFLRFN--EVLKNAVDPNGIIAPGKSGV
2bvfA           LAESGAAPGSEKYPELARELFGLLN-NNSEVTAEMVAEVYKPEVYSRL--AAVKREYDPENRFRHNYNID
1e0yA           CIVFNKKDLIQKRKDDCAANGWGEYRTAFMDQIMETYNWNNSSFLRFN--EVLKNAVDPNGIIAPGKSGV
3c0pA           SLLFSSVAPNRRILRFCDLAGIKTYLARH-TDRSDWVRHFGAAKWNRF--VEMKNKYDPKRLLSPGQD--
3e0tA           DYENNTSPYPESGFEFMQGFGKYFNYADTTLTKEEAQKLYWRGNLEKL--QAIKAKYDPEDVFGNVVSVE
3d2hA           PRLGYVNHIDLDLGIDWGNKTVVNNAIEISRSWGES---YFLSNYERLI--RAKTLIDPNNVFNHPQSIP
3bw7A           ---------------------------------SDWVRHFGAAKWNRF--VEMKNKYDPKRLLSPGQD--
3d2jA           --------------------GNKTVVNNAIEISRSWGESYFLSNYERLI--RAKTLIDPNNVFNHPQSIP
3dq0A           ---------------------------------SDWVRHFGAAKWNRF--VEMKNKYDPKRLLSPGQ---
3d2dA           ----------------------------------------------------------------------
2e3tA           DDIPRYENELSLRLVTSTRAHAKITSIDTSKKVPGFVCFLTAEDVPNS---NATGLFNDETVFAKDEVT-
2e3tB           ----------------------------------------------------------------------
2e1qA           DDIPRYENELSLRLVTSTRAHAKIKSIDTS-EAKKVPGFVCFISADDVPGSNITGICNDETVFAKDKV--
2ckjC           ----------------------------------------------------------------------
2ckjD           ----------------------------------------------------------------------
2ckjA           ----------------------------------------------------------------------
3bdjA           ----------------------------------------------------------------------
2e67A           ------------GLPPEERLGFYLDLPPGLYYLVHHSALPTPEGR--------ALPDWPTREADYFALSH
3cwcA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           Gx
1ahuA           --
1e8gA           --
1dznA           --
1e8fA           --
2bvfA           --
1e0yA           --
3c0pA           --
3e0tA           --
3d2hA           --
3bw7A           --
3d2jA           --
3dq0A           --
3d2dA           --
2e3tA           --
2e3tB           --
2e1qA           --
2ckjC           --
2ckjD           --
2ckjA           --
3bdjA           --
2e67A           P-
3cwcA           --