[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21175.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2afiP.bssp"
#ERROR : Can't open dsspfile "2bejA.bssp"
#ERROR : Can't open dsspfile "1crkA.bssp"
#ERROR : Can't open dsspfile "2bekA.bssp"
#ERROR : Can't open dsspfile "3dreB.bssp"
#ERROR : Can't open dsspfile "2afkF.bssp"
#ERROR : Can't open dsspfile "2bekB.bssp"
#ERROR : Can't open dsspfile "3ea0A.bssp"
#ERROR : Can't open dsspfile "2afiO.bssp"
#ERROR : Can't open dsspfile "1dtsA.bssp"
#ERROR : Can't open dsspfile "1cp2A.bssp"
#ERROR : Can't open dsspfile "2afkG.bssp"
#ERROR : Can't open dsspfile "2afiE.bssp"
#ERROR : Can't open dsspfile "3dreA.bssp"
#ERROR : Can't open dsspfile "3ea0B.bssp"
#ERROR : Can't open dsspfile "2afiF.bssp"
#ERROR : Can't open dsspfile "2afkH.bssp"
#ERROR : Can't open dsspfile "1de0A.bssp"
#ERROR : Can't open dsspfile "2afkE.bssp"
#ERROR : Can't open dsspfile "2afiN.bssp"
#ERROR : Can't open dsspfile "3b6rA.bssp"
#ERROR : Can't open dsspfile "2afiH.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "2afiM.bssp"
#ERROR : Can't open dsspfile "1byiA.bssp"
#ERROR : Can't open dsspfile "3cwqB.bssp"
#ERROR : Can't open dsspfile "1daeA.bssp"
#ERROR : Can't open dsspfile "2cnwD.bssp"
#ERROR : Can't open dsspfile "2cnwE.bssp"
#ERROR : Can't open dsspfile "3bbeA.bssp"
#ERROR : Can't open dsspfile "2cnwF.bssp"
#ERROR : Can't open dsspfile "3cioA.bssp"
#ERROR : Can't open dsspfile "3cwqA.bssp"
#ERROR : Can't open dsspfile "3bfvA.bssp"
#ERROR : Can't open dsspfile "1eg7B.bssp"
#ERROR : Can't open dsspfile "1b25A.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"

## Summary of PDB Search
:264
    2e-39  16%  2afiP  [x.x.x] NITROGENASE IRON PROTEIN 1
    6e-37  43%  2bejA  [x.x.x] SEGREGATION PROTEIN
    7e-36   9%  1crkA  [a.83.1 - d.128.1] CREATINE KINASE
    1e-35  43%  2bekA  [x.x.x] SEGREGATION PROTEIN
    3e-34  10%  3dreB  [x.x.x] CREATINE KINASE B-TYPE
    4e-34  17%  2afkF  [x.x.x] NITROGENASE IRON PROTEIN 1
    5e-34  43%  2bekB  [x.x.x] SEGREGATION PROTEIN
    6e-34  18%  3ea0A  [x.x.x] ATPASE, PARA FAMILY
    8e-34  16%  2afiO  [x.x.x] NITROGENASE IRON PROTEIN 1
    1e-33  12%  1dtsA  [x.x.x] DETHIOBIOTIN SYNTHETASE
    2e-33  19%  1cp2A  [c.37.1] NITROGENASE IRON PROTEIN
    7e-33  17%  2afkG  [x.x.x] NITROGENASE IRON PROTEIN 1
    1e-32  17%  2afiE  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-32  10%  3dreA  [x.x.x] CREATINE KINASE B-TYPE
    5e-32  18%  3ea0B  [x.x.x] ATPASE, PARA FAMILY
    8e-32  16%  2afiF  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-31  17%  2afkH  [x.x.x] NITROGENASE IRON PROTEIN 1
    4e-31  16%  1de0A  [c.37.1] NITROGENASE IRON PROTEIN
    6e-31  17%  2afkE  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-30  17%  2afiN  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-30  10%  3b6rA  [x.x.x] CREATINE KINASE B-TYPE
    3e-28  16%  2afiH  [x.x.x] NITROGENASE IRON PROTEIN 1
    4e-28  15%  1eg7A  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    2e-27  17%  2afiM  [x.x.x] NITROGENASE IRON PROTEIN 1
    5e-27  13%  1byiA  [c.37.1 (1bs1A)] DETHIOBIOTIN SYNTHASE
    6e-26  21%  3cwqB  [x.x.x] PARA FAMILY CHROMOSOME PARTITIONING PROTEIN
    1e-25  12%  1daeA  [x.x.x] DETHIOBIOTIN SYNTHETASE
    1e-24  16%  2cnwD  [x.x.x] CELL DIVISION PROTEIN FTSY
    2e-24  19%  2cnwE  [x.x.x] CELL DIVISION PROTEIN FTSY
    2e-23   9%  3bbeA  [x.x.x] RIBOSOME BIOGENESIS PROTEIN NEP1-LIKE
    2e-21  17%  2cnwF  [x.x.x] CELL DIVISION PROTEIN FTSY
    9e-21  23%  3cioA  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    4e-19  21%  3cwqA  [x.x.x] PARA FAMILY CHROMOSOME PARTITIONING PROTEIN
    4e-19  22%  3bfvA  [x.x.x] MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
    1e-17  14%  1eg7B  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    2e-17  10%  1b25A  [d.152.1 - a.110.1] PROTEIN (FORMALDEHYDE FERREDOXIN
    2e-11  34%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    3e-10  21%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
:264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQIISIINQKGGVGKTTTVINLAAGLAQHEKKVLVIDLDPQGNATTGLGLSNLEGSTDTIYGVLNGTRVI
2afiP           ------IYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLLHSKAQNTIMEMAAEAGTVEDLE
2bejA           VRRIALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLDPQGNATSGLGVRAERGVYHLLQ-------GE
1crkA           ----------------TALAGLKGDLSGKYYSLTNMSERDQQQLIDDHFLFDKPVSPLLTCAGMARDWPD
2bekA           VRRIALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLAPQGNATSGLGVRAERG-------VYHLLQGE
3dreB           --HCSRGERRAIEKLAVEALSLDGDLAGRYYALKSMTEAEQQQLIDDHLFDKPVSPLLLASGMARD-WPD
2afkF           --RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLLHSKAQNTIMEMAAEAGTVEDLE
2bekB           VRRIALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLAPQGNATSGLGVRAERG-------VYHLLQGE
3ea0A           -RVFGFVSAKGGDGGSCIAANFAFALSQEDIHVLAVDISLPFGDLDYLSGNTHSQDLADISNASDRLDKS
2afiO           --RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHKAQNTIMEMAAEAGTVEDLE
1dtsA           -KRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPE--------GLRNSDALALQRNS
1cp2A           --RQVAIYGKGGIGKSTTTQNLTSGLHAMGKTIMVVGCDPKADSTRLL-LGGLAQKSVLDTLREEGEDVE
2afkG           --RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTLILHSKAQNTIMEMAAEAGTVEDLE
2afiE           --RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLLHSKAQNTIMEMAAEAGTVEDLE
3dreA           PPHCSRGERRAIEKLAVALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPD
3ea0B           KRVFGFVSAKGGDGGSCIAANFAFALQEPDIHVLAVDISLPFGDLDYLSGNTHSQDLADISNASDRLDKS
2afiF           --RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTLILHSKAQNTIMEMAAEAGTVEDLE
2afkH           --RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTLILHSKAQNTIMEMAAEAGTVEDLE
1de0A           --RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLIHSKAQNTIMEMAAEAGTVEDLE
2afkE           --RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLLHSKAQNTIMEMAAEAGTVEDLE
2afiN           -----AIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLIHSKAQNTIMEMAAEAGTVEDLE
3b6rA           --HCSRGERRAIEKLAVEASSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSLLLASGMARDWPDA
2afiH           --RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLIHSKAQNTIMEMAAEAGTVEDLE
1eg7A           ILVTAITPTPAGEGKTTTSVGLTDALARLGKRVMVCLREPSLGPSFGIK-GGAAGGGYAQVVPMEDINLH
2afiM           -----AIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTIMEMAAEAGTVDLE
1byiA           -KRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNS---SLQLD
3cwqB           --IITVASFKGGVGKTTTAVHLSAYLALQ-GETLLIDGDPNRSATGWGKRGSLPFKVVDERQAAKYAPKY
1daeA           -KRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALA---------LQRN
2cnwD           -----------GVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAAGGTQLSEW-GKRLSIPVIQGPEGTDP
2cnwE           -----------GVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAAGGTQLSEWGK---RLSIPVIQGPEGT
3bbeA           ------------------------------------------------------------YNIILAKSAL
2cnwF           -----------GVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAAGGTQLSEWGKRLSIPVI-QGPEGTDP
3cioA           NNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNFTVSN----EHGLSEYLAGKDEL
3cwqA           --IITVASFKGGVGKTTTAVHLSAYLALQGETLLIDGDPNRSATGWGKR----------GSLPFKVVDER
3bfvA           VQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDMRK------------PTQHYIFNLPNNEGLS
1eg7B           ILVTAITPTPAGEGKTTTSVGLTDALARLGKRVMVCLREPSLGPSFGIK-GGAAGGGYAQVVPMEDINLH
1b25A           LVVAAKSPLTGGYGDGNLGTMASVHLRRAGYDALVVEGKAKKPVYIYI-EDDNVSILSAEGLWGKTTFET
3do6A           ILVTAVTPTPAGEGKTTTSIGL-SSLNRIGKKSIVTLREPSLGPTLGL----------------------
3cioD           NNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRG------------YSHNLFTVSNEHGLS


                         .         .         *         .         .         .         .:140
query           SDVIRKTEFKNLDIITSNVDLSGLEVETADDSMRAFILKRELTAYLNDSRATYDYVLIDCPPSLSLLTVM
2afiP           LEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEE-----EGAYEDDLDFVFYDVLGDVVCGGFA
2bejA           PLEGLVHPVDGFHLLPATPDLVGATVELAGAPTALRE---------ALRDEGYDLVLLDAPPSLSPLTLN
1crkA           ARGIWHNNDKTFLVWINEEDHTRVISMEKGGNMKRVFER--FCRGLKEVERLIKERGWEFMERLGYVLTC
2bekA           PLEGLVHPVDGFHLLPATPDLVGATVELAGAPTALRE---------ALRDEGYDLVLLDAPPSLSPLTLN
3dreB           ARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTR--FCTGLTQIETLFKSKDYEFMPHLGYILTC
2afkF           LEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEEE-----GAYEDDLDFVFYDVLGDVVFAMPI
2bekB           PLEGLVHPVDGFHLLPATPDLVGATVELAGAPTALR---------EALRDEGYDLVLLDAPPSLSPLTLN
3ea0A           LLDTVQHISPSLDLIPSPATFEKIVNIEPE-------RVSDLIHIA---ASFYDYIIVDFGASIDHVGVW
2afiO           LEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITA-----INFLEEEGAYEDDLDFVFYDVLGDVVFAMPI
1dtsA           SLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLV------MSAGLRALEQQADWVLVEGAGGWFTPLSD
1cp2A           LDSILKEGYGGIRCVESGGPEPGVGCAGRGIITSINMLEQ-----LGAYTDDLDYVFYDVLGDVVCGGFA
2afkG           LEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEE-----EGAYEDDLDFVFYDVLGDVVCGGPI
2afiE           LEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLE-----EEGAYEDDLDFVFYDVLGDVVFAMPI
3dreA           ARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTR--FCTGLTQIETLFKSKDYEFMPHLGYILTC
3ea0B           LLDTVQHISPSLDLIPSPATFEKIVN----------IEPERVSDLIHIAASFYDYIIVDFGASIDHVGVW
2afiF           LEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITA-----INFLEEEGAYEDDLDFVFYDVLGDGGFAMPI
2afkH           LEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLE-----EEGAYEDDLDFVFYDVLGDVVFAMPI
1de0A           LEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEEE-----GAYEDDLDFVFYDVLGDVVCGGPI
2afkE           LEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEE-----EGAYEDDLDFVFYDVLGDVVCGGPI
2afiN           LEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEEE-----GAYEDDLDFVFYDVLGDVVCGGFA
3b6rA           RGIWHNDNKTFLVWVNE---EDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLILTC
2afiH           LEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLE-----EEGAYEDDLDFVFYDVLGCGGFAMPI
1eg7A           FTGDIHAVTYAHNLLAAMVDNHLQQGNVLNIDPRTITWRRVIDLNERA----LRNIVIGLGGKANGVPRE
2afiM           LEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITA-----INFLEEEGAYEDDLDFVFYDVLGDVVCGMPI
1byiA           YATVNPYTFAEPTSPHIISAQEGRPIESLV-----------MSAGLRALEQQADWVLVEGAGGWFTPLSD
3cwqB           QNIVIDTQARDLEALADGCDLLVIPSTPDALALDALLTIETLQKLGNN---RFRILLTIIPPYPSKDGDE
1daeA           SSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAG-----LRALEQQADWVLVEGAGGWFTPLSD
2cnwD           AALAYDAVQAMKARGYDLL-----FVDTAGRLHTKHNLMEELKKVKRA----IAKADPEEPKEVWLVLDA
2cnwE           DPA-ALAYDAVQAMKARGYDLLF--VDTAGRLHTKHNLMEELKKVKRA----IAKADPEEPKEVWLVLDA
3bbeA           ELIPEEIKNKIRKSRVYKYDILDSNYHYKAMEKLKDKEMR----GRPDIIHISLLNILDSPINHEKKLNI
2cnwF           AALAYDAVQAMKAR-----GYDLLFVDTAG----RLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDA
3cioA           NKVIQHFGKGGFDVIT---------RGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAA
3cwqA           QAAKYAPKYQNIVIDTQARP---------------------EDEDLEALADGCDLLVIPSTP--------
3bfvA           SLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQ
1eg7B           FTGDIHAVTYAHNLLAAMVDNHLQQGNVLNIDPRTITWRRVIDLNERA----LRNIVIGLGGKANGVPRE
1b25A           ERELKEKNVGVLTIGPAGENLVKYAVVISQEGRAAGRPGM----GAVMGSKKLKAVVIRGTKEIPVADKE
3do6A           ----------------------------------------------------------------------
3cioD           EYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAA


                         +         .         .         .         .         *         .:210
query           ALVSSHSLLVPLQTEFFALEGLTQLMKTIERIKVNLNPELKIRGILLTMFDKRNKLSTQVEKEARDYFNE
2afiP           MPIRENKAQEIYIVCSGEMMAMYAANNISKGIKYANSGSVRLGGLICNSRNTDR--EDELIIALANKLGT
2bejA           ALAAAEGVVVPVQAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVEAQLRAHFGE
1crkA           PSNLGTGLRAGVHVKLPRLSKDPRFPKILENLRLQKRGTGGVDAAVADVYDISNLDRMGRSEVELVQIVI
2bekA           ALAAAEGVVVPVQAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVEAQLRAHFGE
3dreB           PSNLGTGLRAGVHIKLPNLGKHEKFSEVLKR----LRLQKRVGGVFDVSNADRLGFSEVE--------LV
2afkF           RENKAQEIYIVCSGEMMAMYAANNISKGI--VKYANSGSVRLGGLICNSRNTDR--EDELIIALANKLGT
2bekB           ALAAAEGVVVPVQAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVEAQLRAHFGE
3ea0A           VLEHLDELCIVTTPSLQSLRRAGQLLKLCKE----FEKPISRIEIILNRADTNSRITSDEIEKVIGRP--
2afiO           RENKAQEIYIVCSGEMMAMYAANNISKGI--VKYANSGSVRLGGLICNSRNTDR--EDELIIALANKLGT
1dtsA           TFTFADWVTQQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPA
1cp2A           MEGKAQEIYIVASGEMMALYAANNISKGIQKYAKSGGV----RLGGIICNSRKVANEYELLDAFAKELGS
2afkG           RENKAQEIYIVCSGEMMAMYAANNISKGI--VKYANSGSVRLGGLICNSRNTDR--EDELIIALANKLGT
2afiE           RENKAQEIYIVCSGEMMAMYAANNISKGI--VKYANSGSVRLGGLICNSRNTDR--EDELIIALANKLGT
3dreA           PSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVTAAVGGVFDNADRLGFSEVELV------
3ea0B           VLEHLDELCIVTTPSLQSLRRAGQLLKLCKE----FEKPISRIEIILNRADTSRITSDEIEKVIGRPI--
2afiF           RENKAQEIYIVCSGEMMAMYAANNISKGI--VKYANSGSVRLGGLICNSRNTDR--EDELIIALANKLGT
2afkH           RENKAQEIYIVCSGEMMAMYAANNISKGI--VKYANSGSVRLGGLICNSRNTDR--EDELIIALANKLGT
1de0A           RENKAQEIYIVCSGEMMAMYAANNISKGIVKYAN--SGSVRLGGLICNSRNTDR--EDELIIALANKLGT
2afkE           RENKAQEIYIVCSGEMMAMYAANNISKGI--VKYANSGSVRLGGLICNSRNTDR--EDELIIALANKLGT
2afiN           MENKAQEIYIVCSGEMMAMYAANNISKGI--VKYANSGSVRLGGLICNSRNTDR--EDELIIALANKLGT
3b6rA           PSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVTAAVGGVFDNADRLGFSEVELVQM----
2afiH           RENKAQEIYIVCSGEMMAMYAANNISKGI--VKYANSGSVRLGGLICNSRNTDRE--DELIIALANKLG-
1eg7A           TGF-----DISVASEVMACLCLASDLMDLKERFSRKVVGYTYDGKPVTAGD-------------------
2afiM           RENKAQEIYIVCSGEMMAMYAANNISKGI--VKYANSGSVRLGGLICNSRNTD--REDELIIALANKLGT
1byiA           TFTFADWVTQEQLPVILVVVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPA
3cwqB           ARQLLTTAGLPLFKRGIKRYS--------------AFQKASLNGVVVSEVSDSKAG--IAWSDYKATGKE
1daeA           TFTFADWVTQEQLPVILKLGCINHAMLTAQVIQ---HAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPA
2cnwD           VTGQNGLEQAKKFHEAVGLTGVTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEA-------
2cnwE           VTGQNGLEQAKKFHEAVGLTGVTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEA-------
3bbeA           YIHTYDDKVLKINPETRLPRNYFRFLGVMEKVLKG---------ERNHLIKMEEKTLEDLLNEINAKK--
2cnwF           VTGQNGLEQAKKFHEAVGLTGGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEA-------
3cioA           VVGRVGTSLLVARFGLNTAKEVSLSMQRLEQAGV------NIKGAILNGVIKRASTAYSY---GYNY---
3cwqA           --------------DALALDALLTIETLQKLGNNR-------FRILLTIIPPYPSKDGDEARQLLTTAGL
3bfvA           LFSKFGNVVYVVNSENNNKDEVKKGKELIE------ATGAKLLGVVLNRMPK------------------
1eg7B           TGFDISVASEVMACLCLA----------------------------------------------------
1b25A           ELKKLSQEAYNEILNSPGYPFWKRQGTMAAVEWCNTNYALPTRNFSDGYFEFARSIDGYTMEGMKVQQRG
3do6A           ----------------------------------------------------------------------
3cioD           VVGRVGTSLLVARFGLNTAKEVSLSMQRLEQAGV------NIKGAILNGVIKRAST--------------


                         .         .         .         +         .         .         .:280
query           KVYLTVIPRNVRLSEAPSHGMPVLMYDKSCPGSKSYFNFTDEFINQEQxxxxxx
2afiP           QM-IHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDN--------
2bejA           KVFWTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRLAEEVMARVQ------
1crkA           DGVNYLVDCEKKLEK----GQDIKVPP---------------------------
2bekA           KVFWTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRLAEEVMAR--------
3dreB           QMVVDGVKLLIEMEQRLEQGQAIDDLM---PAQK--------------------
2afkF           QM-IHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDN--------
2bekB           KVFWTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRLAEEVMAR--------
3ea0A           --ISKRIPQDEDAQESLLSGQSVLKVAPKSQLSKTIVDWALH------------
2afiO           Q-MIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDN--------
1dtsA           PL-LGEIPWLAEAATGKYINLALL------------------------------
1cp2A           QL-IHFVPRSPMVTKAEINKQTVIEYDPTCEQAEEYRELARKVDAN--------
2afkG           QM-IHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDN--------
2afiE           Q-MIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDN--------
3dreA           QMVVDGVKLLIEMEQRLEQGQAIDDLM---PAQK--------------------
3ea0B           ---SKRIPQDEDAQESLLSGQSVLKVAPKSQLSKTIVDWALH------------
2afiF           Q-MIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDN--------
2afkH           Q-MIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDN--------
1de0A           Q-MIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDN--------
2afkE           QM-IHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDN--------
2afiN           QM-IHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDN--------
3b6rA           --VVDGVKLLIEMEQRLEQGQAIDDLM---PAQK--------------------
2afiH           TQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDN--------
1eg7A           ------------------------------------------------------
2afiM           Q-MIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDN--------
1byiA           PL-LGEIPWLAENPENAATGKYI-------------------------------
3cwqB           IVE---------------------------------------------------
1daeA           PL-LGEIPWLAAATGKYINLALL-------------------------------
2cnwD           ------------------------------------------------------
2cnwE           ------------------------------------------------------
3bbeA           ---IAIMTKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKVFGDI--------
2cnwF           ------------------------------------------------------
3cioA           ------------------------------------------------------
3cwqA           PLFKRGIKRYSAFQKASLNGVVVSEVSDSKAGWSDYKATGKEIV----------
3bfvA           ------------------------------------------------------
1eg7B           ------------------------------------------------------
1b25A           CPYCNMPCGNVVLDAEGQESELDYENVALLGSNLGIGKLNE-------------
3do6A           ------------------------------------------------------
3cioD           ------------------------------------------------------