[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21176.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cyiA.bssp"
#ERROR : Can't open dsspfile "2auwB.bssp"
#ERROR : Can't open dsspfile "2auwA.bssp"

## Summary of PDB Search
:282
    4e-20  21%  3cyiA  [x.x.x] SULFIREDOXIN-1
    9e-09  14%  2auwB  [x.x.x] HYPOTHETICAL PROTEIN NE0471
    7e-04  13%  2auwA  [x.x.x] HYPOTHETICAL PROTEIN NE0471
:282

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxETKVEINVNKVSISDLVRNKFQPRKTFDAESLQDLTNSIKERGIIQPIIVR
3cyiA           -------------------HSGRIAAVHNVPLSVLIR--PLPSV-LDPAKVQSLVDTIREDPDSVPPIDV
2auwB           ----------------------------------------------------------------------
2auwA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RSSEDNSKYEIIAGERRWLSAQKAGLHEVPVVITNIDDLKSLEFAIIENVQxxxxxxxxEAQGYQRLIEE
3cyiA           LWIQGGDYFYSFGGSHRYAAYQQLQRETIPAKLVQSTDLRVYLGASTPDLQ-------------------
2auwB           -----------------------------------------------------------EVSHEFGDWHR
2auwA           -----------------------------------------------------------EVSHEFGDWHR


                         +         .         .         .         .         *         .:210
query           FSYDQEKVAQFIGKSRSHIANCLRLLNLPQAVLKLIQTQKLSAGHAKILVGLDNAxxxxxxxxxxxxxxx
3cyiA           ----------------------------------------------------------------------
2auwB           NNLSLTTAAEALGISRRVSYYRTAHKIIPRTIWLACLGWEATRPETKTLPRTLPA---------------
2auwA           NNLSLTTAAEALGISRRVSYYRTAHKIIPRTIWLACLGWEATRPETKTL---------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cyiA           ----------------------------------------------------------------------
2auwB           ----------------------------------------------------------------------
2auwA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xx
3cyiA           --
2auwB           --
2auwA           --