[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21179.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bteA.bssp"
#ERROR : Can't open dsspfile "1c8kA.bssp"
#ERROR : Can't open dsspfile "2amvA.bssp"
#ERROR : Can't open dsspfile "1abbA.bssp"
#ERROR : Can't open dsspfile "1axrA.bssp"
#ERROR : Can't open dsspfile "3bjqF.bssp"
#ERROR : Can't open dsspfile "3e3nF.bssp"
#ERROR : Can't open dsspfile "2c1wC.bssp"
#ERROR : Can't open dsspfile "2d5bA.bssp"
#ERROR : Can't open dsspfile "3bjqI.bssp"
#ERROR : Can't open dsspfile "1a8hA.bssp"
#ERROR : Can't open dsspfile "2c1wB.bssp"
#ERROR : Can't open dsspfile "1bs2A.bssp"
#ERROR : Can't open dsspfile "2d54A.bssp"
#ERROR : Can't open dsspfile "2ajgA.bssp"
#ERROR : Can't open dsspfile "3c8zB.bssp"
#ERROR : Can't open dsspfile "2ajhB.bssp"
#ERROR : Can't open dsspfile "2ajgB.bssp"
#ERROR : Can't open dsspfile "3c8zA.bssp"
#ERROR : Can't open dsspfile "3bicA.bssp"
#ERROR : Can't open dsspfile "2csxA.bssp"
#ERROR : Can't open dsspfile "2dlcX.bssp"
#ERROR : Can't open dsspfile "2bvtA.bssp"
#ERROR : Can't open dsspfile "2aelA.bssp"
#ERROR : Can't open dsspfile "3egbB.bssp"
#ERROR : Can't open dsspfile "2aelB.bssp"
#ERROR : Can't open dsspfile "2bcvA.bssp"
#ERROR : Can't open dsspfile "2c1fA.bssp"
#ERROR : Can't open dsspfile "3dpgA.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "2ag6A.bssp"
#ERROR : Can't open dsspfile "3bicB.bssp"
#ERROR : Can't open dsspfile "3dl5B.bssp"
#ERROR : Can't open dsspfile "2ct8A.bssp"
#ERROR : Can't open dsspfile "3c5fA.bssp"
#ERROR : Can't open dsspfile "2aekA.bssp"
#ERROR : Can't open dsspfile "1b80A.bssp"
#ERROR : Can't open dsspfile "2c1sA.bssp"
#ERROR : Can't open dsspfile "2bcrA.bssp"
#ERROR : Can't open dsspfile "3cglD.bssp"
#ERROR : Can't open dsspfile "3e3nB.bssp"
#ERROR : Can't open dsspfile "2azxA.bssp"
#ERROR : Can't open dsspfile "2bcqA.bssp"
#ERROR : Can't open dsspfile "3cglC.bssp"
#ERROR : Can't open dsspfile "1a1xA.bssp"
#ERROR : Can't open dsspfile "2a6tA.bssp"
#ERROR : Can't open dsspfile "3e3nA.bssp"
#ERROR : Can't open dsspfile "3d6uA.bssp"
#ERROR : Can't open dsspfile "3e3nD.bssp"
#ERROR : Can't open dsspfile "3d6vA.bssp"
#ERROR : Can't open dsspfile "1cjyB.bssp"
#ERROR : Can't open dsspfile "3e3nH.bssp"
#ERROR : Can't open dsspfile "1b25A.bssp"
#ERROR : Can't open dsspfile "3cfiJ.bssp"
#ERROR : Can't open dsspfile "2c1qA.bssp"
#ERROR : Can't open dsspfile "3ecjA.bssp"
#ERROR : Can't open dsspfile "1bt1A.bssp"
#ERROR : Can't open dsspfile "1ei5A.bssp"
#ERROR : Can't open dsspfile "2cfoA.bssp"
#ERROR : Can't open dsspfile "2cybB.bssp"
#ERROR : Can't open dsspfile "2cycA.bssp"
#ERROR : Can't open dsspfile "2cfoB.bssp"
#ERROR : Can't open dsspfile "2arlA.bssp"
#ERROR : Can't open dsspfile "3bjqH.bssp"
#ERROR : Can't open dsspfile "3bjqE.bssp"
#ERROR : Can't open dsspfile "3ci0I.bssp"
#ERROR : Can't open dsspfile "2e50B.bssp"
#ERROR : Can't open dsspfile "2cybA.bssp"
#ERROR : Can't open dsspfile "2ab5B.bssp"
#ERROR : Can't open dsspfile "3c98A.bssp"
#ERROR : Can't open dsspfile "2crqA.bssp"
#ERROR : Can't open dsspfile "2an2A.bssp"
#ERROR : Can't open dsspfile "1bdgA.bssp"
#ERROR : Can't open dsspfile "2d26A.bssp"
#ERROR : Can't open dsspfile "2akeA.bssp"
#ERROR : Can't open dsspfile "2d5bA.bssp"
#ERROR : Can't open dsspfile "3c8zB.bssp"
#ERROR : Can't open dsspfile "3c8zA.bssp"
#ERROR : Can't open dsspfile "2csxA.bssp"
#ERROR : Can't open dsspfile "2ag6A.bssp"
#ERROR : Can't open dsspfile "2ct8A.bssp"
#ERROR : Can't open dsspfile "3d6vA.bssp"
#ERROR : Can't open dsspfile "2cybB.bssp"

## Summary of PDB Search
:844
    e-137  37%  2bteA  [x.x.x] LEUCYL-TRNA SYNTHETASE
    8e-63  10%  1c8kA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    3e-59  10%  2amvA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    2e-58   9%  1abbA  [c.87.1] GLYCOGEN PHOSPHORYLASE B
    5e-56   9%  1axrA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    6e-50  10%  3bjqF  [x.x.x] PHAGE-RELATED PROTEIN
    1e-47   9%  3e3nF  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-43  15%  2c1wC  [x.x.x] ENDOU PROTEIN
    1e-41  18%  2d5bA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    4e-41  12%  3bjqI  [x.x.x] PHAGE-RELATED PROTEIN
    4e-40  19%  1a8hA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    2e-39  13%  2c1wB  [x.x.x] ENDOU PROTEIN
    2e-38  11%  1bs2A  [d.67.2 - c.26.1 - a.27.1] PROTEIN (ARGINYL-TRNA SYNTHETASE)
    4e-38  19%  2d54A  [x.x.x] METHIONYL-TRNA SYNTHETASE
    8e-37  38%  2ajgA  [x.x.x] LEUCYL-TRNA SYNTHETASE
    2e-35  13%  3c8zB  [x.x.x] CYSTEINYL-TRNA SYNTHETASE
    5e-34  37%  2ajhB  [x.x.x] LEUCYL-TRNA SYNTHETASE
    6e-34  37%  2ajgB  [x.x.x] LEUCYL-TRNA SYNTHETASE
    7e-34  14%  3c8zA  [x.x.x] CYSTEINYL-TRNA SYNTHETASE
    6e-31   8%  3bicA  [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
    6e-31  20%  2csxA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    1e-30  11%  2dlcX  [x.x.x] TYROSYL-TRNA SYNTHETASE, CYTOPLASMIC
    1e-30   9%  2bvtA  [x.x.x] BETA-1,4-MANNANASE
    2e-30   7%  2aelA  [x.x.x] TRICHODIENE SYNTHASE
    3e-30  12%  3egbB  [x.x.x] PROTEIN PELLINO HOMOLOG 2
    3e-30   7%  2aelB  [x.x.x] TRICHODIENE SYNTHASE
    8e-29  12%  2bcvA  [x.x.x] DNA POLYMERASE LAMBDA
    9e-29  13%  2c1fA  [x.x.x] BIFUNCTIONAL ENDO-1,4-BETA-XYLANASE A
    1e-28  10%  3dpgA  [x.x.x] SGRAIR RESTRICTION ENZYME
    5e-28  12%  1d2rA  [c.26.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    6e-28  13%  2ag6A  [x.x.x] TYROSYL-TRNA SYNTHETASE
    6e-28   7%  3bicB  [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
    2e-27   8%  3dl5B  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    5e-27  17%  2ct8A  [x.x.x] METHIONYL-TRNA SYNTHETASE
    1e-26  13%  3c5fA  [x.x.x] DNA POLYMERASE LAMBDA
    7e-25  13%  2aekA  [x.x.x] TRICHODIENE SYNTHASE
    7e-24   6%  1b80A  [a.93.1] PROTEIN (RECOMBINANT LIGNIN PEROXIDASE H8)
    1e-23   8%  2c1sA  [x.x.x] BIOTIN BINDING PROTEIN A
    2e-23  12%  2bcrA  [x.x.x] DNA POLYMERASE LAMBDA
    6e-23   5%  3cglD  [x.x.x] GFP-LIKE FLUORESCENT CHROMOPROTEIN DSFP483
    6e-23  20%  3e3nB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    1e-22  10%  2azxA  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    1e-22  12%  2bcqA  [x.x.x] DNA POLYMERASE LAMBDA
    5e-22   5%  3cglC  [x.x.x] GFP-LIKE FLUORESCENT CHROMOPROTEIN DSFP483
    2e-21  11%  1a1xA  [x.x.x] HMTCP-1
    9e-21  13%  2a6tA  [x.x.x] SPAC19A8.12
    5e-20  21%  3e3nA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    6e-20  16%  3d6uA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    1e-19  21%  3e3nD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-18  17%  3d6vA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    2e-18  10%  1cjyB  [b.7.1 - c.19.1] PROTEIN (CYTOSOLIC PHOSPHOLIPASE A2)
    4e-17  21%  3e3nH  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    1e-16  14%  1b25A  [d.152.1 - a.110.1] PROTEIN (FORMALDEHYDE FERREDOXIN
    1e-16  13%  3cfiJ  [x.x.x] TYPE II SECRETORY PATHWAY, PSEUDOPILIN EPSI
    3e-16   9%  2c1qA  [x.x.x] BIOTIN BINDING PROTEIN A
    5e-16  10%  3ecjA  [x.x.x] PROTEIN (HOMOPROTOCATECHUATE 2,3-DIOXYGENASE)
    2e-15  12%  1bt1A  [a.86.1] PROTEIN (CATECHOL OXIDASE)
    2e-15   9%  1ei5A  [e.3.1 - b.61.3 - b.61.3] D-AMINOPEPTIDASE
    7e-15  13%  2cfoA  [x.x.x] GLUTAMYL-TRNA SYNTHETASE
    1e-14  14%  2cybB  [x.x.x] TYROSYL-TRNA SYNTHETASE
    6e-14   8%  2cycA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    1e-13  13%  2cfoB  [x.x.x] GLUTAMYL-TRNA SYNTHETASE
    4e-13  10%  2arlA  [x.x.x] GFP-LIKE NON-FLUORESCENT CHROMOPROTEIN
    5e-13  16%  3bjqH  [x.x.x] PHAGE-RELATED PROTEIN
    1e-12  10%  3bjqE  [x.x.x] PHAGE-RELATED PROTEIN
    1e-12  11%  3ci0I  [x.x.x] PSEUDOPILIN GSPI
    6e-12   6%  2e50B  [x.x.x] PROTEIN SET
    3e-10  19%  2cybA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    2e-09  11%  2ab5B  [x.x.x] MRNA MATURASE
    9e-08   7%  3c98A  [e.25.1 (1dn1A)] SYNTAXIN-BINDING PROTEIN 1
    3e-07  11%  2crqA  [x.x.x] MITOCHONDRIAL TRANSLATIONAL INITIATION FACTOR 3
    1e-06  10%  2an2A  [x.x.x] P332G A333S DOUBLE MUTANT OF NITRIC OXIDE
    7e-06   7%  1bdgA  [x.x.x] HEXOKINASE
    1e-04  14%  2d26A  [x.x.x] ALPHA-1-ANTITRYPSIN
    6e-04  17%  2akeA  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    3e-16  16%  2d5bA  [x.x.x] METHIONYL-TRNA SYNTHETASE(query 436->785)
    6e-05  10%  3c8zB  [x.x.x] CYSTEINYL-TRNA SYNTHETASE(query 475->720)
    3e-07   9%  3c8zA  [x.x.x] CYSTEINYL-TRNA SYNTHETASE(query 424->720)
    4e-19  14%  2csxA  [x.x.x] METHIONYL-TRNA SYNTHETASE(query 331->789)
    7e-04  11%  2ag6A  [x.x.x] TYROSYL-TRNA SYNTHETASE(query 589->679)
    6e-23  15%  2ct8A  [x.x.x] METHIONYL-TRNA SYNTHETASE(query 331->789)
    6e-05  12%  3d6vA  [x.x.x] TYROSYL-TRNA SYNTHETASE(query 468->708)
    1e-07  13%  2cybB  [x.x.x] TYROSYL-TRNA SYNTHETASE(query 495->711)
:844

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDRYNFKTVEEKWQKFWHKNKVFSSKLDKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGY
2bteA           MEKYNPHAIEAKWQRFWEEKGFMKAKLPGGRGKQYVLVMFPYPSGDLHMGHLKNYTMGDVLARFRRMQGY
1c8kA           MRLWSAKAPNDFNLKDFNVGGYIQAVLDR--NLAENISRVLYPNDNFFEGKELRATLQDIIRRFKS-SKF
2amvA           MRLWSAKAPNDFNLKDFNVGGYIQAVLDR--NLAENISRVLYPNDNFFEGKEVAATLQDIIRRFK-SSKF
1abbA           MRLWSAKAPNDFNLKDFNVGGYIQAVLDR--NLAENISRVLYPEGKERLKQEYFATLQDIIRRFKS-SKF
1axrA           GYRNNVVNTMRLWSAKAPNDFNLKDFNVLDRNLAENISRVLYPNDNFFEGKEVAATLQDIIRRFKS-SKF
3bjqF           ----------------------------------------------HARGYRQSTLIGKKLFPVAPVYGG
3e3nF           --LAMPYDTPVPGYRNNVVNTMRLWSAKAPNGYIQAVLDRENISRVLYGKELRLATLQDIIRRFK-SSKF
2c1wC           --------LSKLFNELWDADQ---NRMKSGKDYRISLQGKAGYVSFPLFQFVDEEKLRKTFATFISLLD-
2d5bA           ------------------------------EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGY
3bjqI           --------------------------------------------------------------ILSTHARG
1a8hA           ------------------------------EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGY
2c1wB           --------LSKLFNELWDADQNRMKSGKDRISLQGKAGYVPSASFPLFQFVDEEKLKSRKTFATFISLLD
1bs2A           --FFNPQFLAKLVIPDILTRKEDYGSCKLVENKKVIIEFSPNIAKPFHAGHLRSTIIGGFLANLYEKLGW
2d54A           ------------------------------EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGY
2ajgA           ----------------------------------------------------------------------
3c8zB           MMQSWSAPAIPVVPGRGPALRLFQVRPVTPGPTATMYVCGITPYDATHLGHAATYLTFDLVHRLWLDAGH
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
3c8zA           --QSWSAPAIPVVPGRGPALRLFQVRPVTPGPTATMYVCGITPYDATHLGHAATYLTFDLVHRLWLDAGH
3bicA           ----------------------------------------------------------------------
2csxA           ------------------------------MKKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDY
2dlcX           --NEAFGLITKNLQEVLNPQIIK-DVLEVQKRHLKLYWG-TAPTGRPHCGY----FVPMTKLADFLKAGC
2bvtA           ----------------------------------------------------------------------
2aelA           LEITSAIAQMENWMVWVNDLMSFYKEFDDERDQISLVKNYVVSDE-ISLHEALEKLTQDTLHSSKQFSDK
3egbB           ------------VHVISTCKGQHSISYTLSRNQTVVVEYTHDKDTDMQVGRSTESPIDFVVTDTQITQ-S
2aelB           LEITSAIAQMENWMVWVNDLMSFYKEFDDERDQISLVKNYVVSDE-ISLHEALEKLTQDTLHSSKQMSDK
2bcvA           VDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLRRHRRLDIIVVPYSEFAC
2c1fA           ------------------------------FTVGNGQ-NQHKGVNDGFSYEIWLDN----------TGGN
3dpgA           -------------------TRNLATTERCIQDIRNAPVRNRSTQFQLAQQNMLAYTFGEVIPGFASA-GI
1d2rA           ----------------------------------------IQPSGVITIGNYIGALRQFVELQH------
2ag6A           --------MIKRNTSEIISEEELREVLKKDEKSALI---GFEPSGKIHLGH------------YLQIKKM
3bicB           ----------------------------------------------------------------------
3dl5B           ---------NGAYRENRTGISIFGQMMRFDMRESFPLLTTKKVFIRSIFEELIWFIKGDTNGNHLIEKKV
2ct8A           ------------------------------MKKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDY
3c5fA           GDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRRHRRLDIIVVPYSEFAC
2aekA           LEITSAIAQMENWMVWVNDLMSFYKEFDDERDQISLVKN-YVVSDEISLHEALEKLTQDTLHSSKQMVAK
1b80A           ----------------------------------------------------------------------
2c1sA           --------LQGLWRNELGSNMTISALDVAGTFSGSYQTAVTATNKQILVSPLKGAQQPPGTKGQQPTFGF
2bcrA           VDVLITHPDGRSHRGIFSRLLDSLRQ-EGFLTDDLVSQEENGQQQKYLGVCRRRHRRLDIIVVPYSEFAC
3cglD           ----------------------------------------------------------------------
3e3nB           --------------------------------------RVLYPGKELRLKQVVAATLQDIIRRFKS-SKF
2azxA           --INRIERATGQRPHHFLRRGIFFSHRDNQNKKPFYLYTGRGPSSEAHVGHLIPFIFTKWLQD-------
2bcqA           --HPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLPGPGRRHRRLDIIVVPYSEFAC
3cglC           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2a6tA           ---------------------------------------------------------------FTNATFS
3e3nA           -------------------------------------------------------TLQDIIRRFKS-SKF
3d6uA           -----FEMIKRNTSEIISEEELRE-VLKKDEKSAIIG---FEPSGKIHLGH------------YLQIKKM
3e3nD           -------------------------------------------------------TLQDIIRRFKS-SKF
3d6vA           -----FEMIKRNTSEIISEEELRE-VLKKDEKSAII--GF-EPSGKIHLGH------------YLQIKKM
1cjyB           ----------------------------------------------------------------------
3e3nH           -------------------------------------------------------TLQDIIRRFKS-SKF
1b25A           DDLYKAADRVYSLIRAYWVREFNGKWDRKMDYPPKRWFTEGLKSGPHKGEHLDEKKYDELLSEYYRI---
3cfiJ           ------------------------------------------------------------INTVGYLEQK
2c1qA           ---------QGLWRNELGSNMTIS-ALDVAGT--FSGSYQTAVTATKQILVSPLKGAQQPPKGQQPTFGF
3ecjA           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
2cfoA           ----------------------------------VRVRLAPSPTGNLHIGTARTAVFNWLYARH-----R
2cybB           ---EKLRLITRNAEEVVTEEELR--QLIETKEKPRAYVGYE-PSGEIHLGH------------MMTVQKL
2cycA           --EERINLVLKKPTEEVLTVENLRHLFEIGAPLQHY--IGFEISGYIHLGT---GLMAGAKIADFQKAGI
2cfoB           ----------------------------------VRVRLAPSPTGNLHIGTARTAVFNWLYARHR--GGK
2arlA           ----------------------------------------------------------------------
3bjqH           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------HVLEEK
2e50B           ----------------------------------------------------------------------
2cybA           ---------TRNAEEVVTEEELR--QLIETKEKPRAYVGYE-PSGEIHLGH------------MMTVQKL
2ab5B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2d26A           -----------KWERPFEVKDTEEEDFHVDQVTTVKVPM-MKRLGMFNIQHSKKLSSWVLLMKYLGNATA
2akeA           -------------------------DAYENKKPFYLYTGR-GPSSEAHVGHL----IPFIFTKWLQDVFN
2d5bA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NVLHPMGWDSFGMPAENAARQNNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFL
2bteA           EVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLMGILYDWDREVTTCEPEYYRWNQWIFL
1c8kA           GCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLWDKAWEVTVKTCAYTNHTVIPEALERWPVHLLE
2amvA           GCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMLDWDKAWEVTVKTCAYT-NHTVLPEALERWPVHLLE
1abbA           GCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLEWEVTVKTCAYTNHTVIPEALERWPVHLLE
1axrA           GCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLEREVTVKTCAYTNHTVLPEALERWPVHLHL
3bjqF           KI-LTFGKEAFRLYNTKRAPGAN--------------TKRIDFGYEGDPYSIVPSALEAKVPRELRDASQ
3e3nF           GCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLEWEVTVKTCAYTNHTVLPEALERWPVHLLE
2c1wC           NYEMDTGVAEVVTPEEIAENNNFLDAILETK--------VMKMAHDYLVRKNQAKPTRNDFKVQLYNIWF
2d5bA           RTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLG--IAYDDFIRTTEERHKKVVQLVLK
3bjqI           YRQSTLIGKKLFPVAPVA----------QYGGKILTFGKEAFRLYNTKRTKRI--DFGYEGDPYSIVPSA
1a8hA           RTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLG--IAYDDFIRTTEERHKKVVQLVLK
2c1wB           NYEMDTGVAEVVTPEEIAENNNFLDAILETK--------VMKMAHDYLVRKNQAKPTRNDFKVQLYNIWF
1bs2A           EVIRMNYLGDWGKQFGLLAVGFEGNEEALVKDPIHHLFDVYVRINKDIEEEGDSIPLEQSTNGKAREYFK
2d54A           RTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLG--IAYDDFIRTTEERHKKVVQLVLK
2ajgA           ----------------------------------------------------------------------
3c8zB           TVQYVQNVTDVDDPLFERAERDGIDWRTLGDRETQLFREDMAALRVLPPHDYVAAT---DAIAEVVEMVE
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
3c8zA           TVQYVQNVTDVDDPLFERAERDGIDWRTLGDRETQLFREDMAALRVLPPHDYVAAT---DAIAEVVEMVE
3bicA           ----------------------------------------------------------------------
2csxA           DVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAERFKKLWEFLK--IEYTKFIRTTDPYHVKFVQKVFE
2dlcX           EVTVLLADLHAFLDNMKAPLEVVNY---RAKYYELTIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIF
2bvtA           ----------------------------------------------------------------------
2aelA           DPQVMDTIECFMHGYVTWHLCDRKYRLSEITEDAQKFCKFYEQAANVGAVSPSEWAYPPVAQLAN-----
3egbB           TISRFACRIVCDRNEPYTARIFA--AGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPRQPGVWR
2aelB           DPQVMDTIECFMHGYVTWHLCDRKYRLSEITEDAQKFCKFYEQAANVGAVSPSEWAYPPVAQLAN-----
2bcvA           ALLYFTGSAHFNRSMRALAKTKGMSLSEHA--LSTAVVRNTHGCK--VGPGRVLPTPTE------KDVFR
2c1fA           GSMLGSGATFKAEWNAAVNRGNFLARRGLDFGSQKKATDYDYGLDYAATYKQTASASRLCVYGWFQNRGL
3dpgA           NGMDYR--DVIGRPVENAVT-EGTHFFRDDFRVDSNAKAKVAGDIFEIVSSAVMWNCAARWN---SLMVG
1d2rA           ------EYNCYFCIVDQHAITVWQDPH-ELRQNIRRLAALYLAVGIDPTQ----------ATLFIQSEVP
2ag6A           IDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYNKKVFEAMGLKAKYVYGSSFQLDKDYTLNVYRLA
3bicB           ----------------------------------------------------------------------
3dl5B           YIWSGNGSKEYLERIGLGHREENDLGPIYGF--------QWRHYN--GEYKTMHDDYTGVGVDQLAKLIE
2ct8A           DVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAERFKKLWEFLK--IEYTKFIRTTDPYHVKFVQKVFE
3c5fA           ALLYFTGSAHFNRSMAALAKTKGMSLSEHA--LSTAVVRNTHGCK--VGPGRVLPTPTE------KDVFR
2aekA           DPQVMDTIECFMHGYVTWHLCDR------------------------KYRLSEIYEKVKEEKTEDAQKFC
1b80A           ----------------------------------------------------------------------
2c1sA           TVQWQFTTVFVGQCFVDRRGKEMLEMAWLLREEVPSRKDTWKATRVGTNV--------------------
2bcrA           ALLYFTGSAHFNRSMRALAKTKGMSLSEHA--LSTAVVRNTHGCKVGPGRV--LPTPTE------KDVFR
3cglD           ----------------------------------------------------------------------
3e3nB           GCRDPVRTNFDAFPDKVAIQLNDTHPSLAI---PELMRVLVDLERLDWDWEVTVKTCAEALERWPVHLLE
2azxA           -----VFNVPLVIQTDDEKYLWKDLTLDQAYGDAVENAKDIIA--CGFDINKTFIFSDLDYGSSGFYKNV
2bcqA           ALLYFTGSAHFNRSMRALAKTKGMSLSEHA--LSTAVVRNTHGCKVGPGRVLPTPT--------EKDVFR
3cglC           ----------------------------------------------------------------------
1a1xA           --------EDVGAPPDHLWHQEGIYRDAVVEEETSFLRARVQQIQVPLGDAARPSHLLTS-----QLPLM
2a6tA           QVLDDLSARFLNLPAEEQSSVFQIEQAHWFEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWHEEAFDD
3e3nA           GCRDPVRTNFDAFPDKVAIQLNDTHPSLAI---PELMRVLVDLERLDWDWEVTVKTCAEALERWPVHLLE
3d6uA           IDLQNAGFDIIILLADLFAYLNQKGELDEIRKIGDYNKKVFEAMGLKAKYVYGSSFMLDKDYTLNVYRLA
3e3nD           GCRDPVRTNFDAFPDKVAIQLNDTHPSLAI---PELMRVLVDLERLDWDWEVTVKTCAEALERWPVHLLE
3d6vA           IDLQNAGFDIIILLADLFAYLNQKGELDEIRKIGDYNKKVFEAMGLKAKYVYGSSFMLDKDYTLNVYRLA
1cjyB           ----------------------------------------------------------------------
3e3nH           GCRDPVRTNFDAFPDKVAIQLNDTHPSLAI---PELMRVLVDLERLDWDWEVTVKTCAEALERWPVHLLE
1b25A           -----RGWDERGIPKKETLKELD------LDFVIPELEKVTN----------------------------
3cfiJ           MFA---AMVADNQMAMVMLNPKAGQTWYWKVAPVATTQPLLKAFDVSVAAEKQASPIITVR---------
2c1qA           TVQWQFTTVFVGQCFVDRRGKEMLEMAWLLREEVPSRKDTWKATRVGTNV--------------------
3ecjA           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
2cfoA           GGKFILRI-------------EDTDRERSRPEYTENILEGLQWLGLTWDEGP---YFQSDRLDLYRQAIQ
2cybB           MDLQEAGFEIIVLLADIHAYLNEKGTFEEIAEVADYNKKVFIALGLDESRAKFVLGSEYQLSRDYVLDVL
2cycA           KTRVFLADW-HSWINDKLGGDLEVIQEVALKYFKVGMEKSIEVMGGDPKKVEFVLASEILEKGDYWQTVI
2cfoB           FILRIEDT----------------DRERSRPEYTENILEGLQWLGLTWDEGP---YFQSDRLDLYRQAIQ
2arlA           ----------------------------------------------------------------------
3bjqH           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           TVAGTRGQRAVRQQGESDA-----GSRWYWRTTPLSTGNALQAVDIEVSLHEDFSSVIQSRRA-------
2e50B           ----------------------------------------------------------------------
2cybA           MDLQEAGFEIIVLLADIHAYLNEKGTFEEIAEVADYNKKVFIALGLDESRAKFVLGSEYQLSRDYVLDV-
2ab5B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
1bdgA           ----------------------------LDCWRTQFDKSMDIDSLHPGKQLYEKMVSGMYLGELVRHIIV
2d26A           IFFLPDEGKLQHLENELTHRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSEAPLKKAVHKAVL
2akeA           VPLV------IQMTDDEKYLWKDLTLDQAYS-YAVENAKDIIACG--FDINKTFIFSDLDYMGMSSGFYK
2d5bA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DLYDKGLVYRKENYVNWDPVDETVLANEQVVDGKGWRSGATVERKKLNQWFFNISKFSEDLLQGLDALEN
2bteA           KMWEKGLAYRAKGLVNWCPKCQTVLANEQVVERCWRHEDTPVEKRELEQWYLRITAYAERLLKDLEGLN-
1c8kA           TLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEIL
2amvA           TLLPRHLQIIYEIVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKD
1abbA           TLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEIL
1axrA           QIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKD
3bjqF           VPGIGARSVNTVLRIALAHEHECAQIAL-------------------------------------DPAKY
3e3nF           TLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEIL
2c1wC           QLYSRAPGSRPDSCGFEHVFVGESKRGQE------------MMGLHNWVQFYLQEKRKNIDYKGYVARQN
2d5bA           KVYEAGDIYYGEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPD
3bjqI           LEAKVPRELRDASQVPGIDLGARSVNTVLRIALAHEH--------ECAQIALDPAKY-------------
1a8hA           KVYEAGDIYYGEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQPDLI
2c1wB           QLYSRAPGSRPDSCGFEHVFVGESKRGQEMMGLHNW------------VQFYLQEKRKNIDYKGYVARQN
1bs2A           RMEDGDEEALKIWKRFREFSIEKYIDTYARIKYDVYSGESQVSKESMLKAIDLFKEKGLTHEDKGAVLID
2d54A           KVYEAGDIYYGEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPI
2ajgA           ----------------------------------------------------------------------
3c8zB           KLLASGAAYIVEDAEYPDVYFRADATAQFGYESGYDRDTMLTLFAERGGDPDRPGKSDQLDALLWRAERP
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
3c8zA           KLLASGAAYIVEDAEYPDVYFRADATAQFGYESGYDRDTMLTLFAERGGDPDRPGK--------------
3bicA           ----------------------------------------------------------------------
2csxA           ECYKRGDIYLGEYKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRPRSRVK
2dlcX           RLSNIVSQNDAKRAGADVVKQVA--------------------NPLLSGLIYPLMQALDEQFLDVDQFGG
2bvtA           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
3egbB           EISVCGDVYTLR--ETRSAQQRGKLVESETDGSLIDLCGATLLWRTADGLFHTPTQKHIEAL--------
2aelB           ----------------------------------------------------------------------
2bcvA           LL---GLPYREPAERDW-----------------------------------------------------
2c1fA           NGVPLVEYYIIEDWVDWVPDAKMVTIDGAQYKIFQDHTGPTINGGSEQYFSVRQQKRTSGHITVSDHFKE
3dpgA           EGWRSQPRYSRPTLSPSPRRQVA---VLNLPRSFDWVSLLVPESQEVIEEFRAGLRK-DGLGLPTSTPDL
1d2rA           AHAQAAWMLQCIVYIGELERMTQFKEPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFT
2ag6A           LKTTLKRARRSMELIAREDENPKVAEVIQVNPLHYEGVDVAVGGMEQRKIHMLARELLPKKVCIHNPVLT
3bicB           ----------------------------------------------------------------------
3dl5B           TLKNNPKDRR-HILTAWNPSA--LSQMALPPCHVLSQYYVTNDNCLSCNLYQRS----------------
2ct8A           ECYKRGDIYLGEYEKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRPRSRV
3c5fA           LL---GLPYREPAERDW-----------------------------------------------------
2aekA           KFYEQAANVGAVSPSEWAYPPVAQLAN-------------------------------------------
1b80A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
2bcrA           LL---GLPYREPAERDW-----------------------------------------------------
3cglD           ----------------------------------------------------------------------
3e3nB           TLLPRHLQIIYEINAAAFPGDVDRLRRMSLVEEGA-----------------------------------
2azxA           ------VKIQKHVTFNQVKGIFGFTDSDCIGKISFPA------IQAAPSFSNSFPQIFRDRTDIQCLIPC
2bcqA           LL---GLPYREPAERDW-----------------------------------------------------
3cglC           ----------------------------------------------------------------------
1a1xA           WQLYPEERYMDNNSRLWQIQHHLMVRGQELL---------------------------------------
2a6tA           FLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGFPKGKIDVDCAIREVYEETGFDCSSRINPN-EFI
3e3nA           TLLPRHLQIIYEINAAAFPGDVDRLRRMSLVEEGA-----------------------------------
3d6uA           LKTTLKRARRSMELIAREDENPKVEVIYPIMQVNPLHYGVDVAVGGMEQRKI------------------
3e3nD           TLLPRHLIYEINQRFAAFPGDVDRLRRMSLVEEGA-----------------------------------
3d6vA           LKTTLKRARRSMELIAREDENPKVAEVIYPIM--------------------------------------
1cjyB           ----------------------------------------------------------------------
3e3nH           TLLPRHLQRFLNRVAAAFPGDVDRLRRMSLV---------------------------------------
1b25A           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
2cfoA           TLLDKGLAYYC-YCTPEELEALRAEQKAKGQAPRYDNRHRHLTPEEQAAFEAAGRTPVIRFKIEDDRQIE
2cybB           KMARITTLNRARRSMEDPMVSQMIYPLMQALDIAHLGVDLAVGGIDQRKIHMLARENLPRLGYSSPVCLH
2cycA           DISKNVTLSRVMRSITI-----------------------------------------------------
2cfoB           TLLDKGLAYYCYCTPEELE-ALRAEQKAKGQAPRYDNRHRHLTPEEQAAFEAAGRTPVIRFKIEDDRQIE
2arlA           ----------------------------------------------------------------------
3bjqH           -----GDPYSIVPSALEAKVPRELRDASQVPGIDLGARSVNTVLRIALAHEHECAQIALDPAK------Y
3bjqE           --KEAFRLYNTKRAPGANTKRGYEGDPYSIVPSALEAKVPRELGARSVNTVLRIALAHEHECAQIALDPA
3ci0I           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
1bdgA           YLVEQKILFRGDLPERLKVRNSLLTRYLTDV---------------------------------------
2d26A           TIDEKGTEAAGAMFLEAIP---------------------------------------------------
2akeA           NVVKIQKHVT------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           WPNKVKVMQKNWIGKSFGCEVEFKIESEKPIESIKCYTTRPDTLFGFSFLALSVDHPLAKYYEEDKEFQK
2bteA           WPEKVKAMQRAWIGRSEGAEILFPV--EGKEVRIPVFTTRPDTLFGATFLVLAPEHPLTLAPEKREEVLA
1c8kA           KKTIFKDFYELEPHKFQNKTNGITPRRW--LVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFI
2amvA           FYELEPHKFQNKTNGITPR----RWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAIRDVAKV
1abbA           KKTIFKDFYELEPHKFQNKTNGITPRR-WLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIR
1axrA           FYELEPHKFQNKTNGITPRRWLVLCNPGLAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLK
3bjqF           NADHKVKLVGSARWTSPDSDPTKDVETAK--EAIADSIGEPNRLLSRKALSACKYHPKLIEITID-----
3e3nF           KKTIFKDFYELEPHKFQNK--TNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFI
2c1wC           EDDQVLNLQFNWKEMVKP----------------------------------------------------
2d5bA           RPEGYRNEVLAMLAEPIGDLSISRPKVPWGIPLPWDENHVTFVWFDALLNYVSALDYPEGEAYRTFHAWH
3bjqI           NADHKVKLVGSARWTSPDSDPTKDVETAKEAIAD--SIGEPNRLLSRKALSACKYHPKLIERVSITIDLK
1a8hA           RPEGYRNEVLAMLAEPIGDLSISRPKVPWGIPLPWDENHVTYVWFDALLNYVSALDYPEGEAYRTFWPHA
2c1wB           EDDQVLNLQFNWKEMVKPVGSSFIGVSPEFEFALYVFLASQEKM--------------------------
1bs2A           LTKFNKKLGKAIVQKSDGTTLYLTRDVGAA--MDRYEKYHFDKMIYVIASQQDLHAAQFFEILKQMGFEW
2d54A           RPEGYRNEVLAMLAEISRPKSRVPWGIPLPWDENHVTAVWFDALLNY----VSALDYPEGEAYRTFHAWH
2ajgA           -----------------GVEITFNVNDYD--NTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPEAA
3c8zB           GEPSWPSPFGRG----------------------------------------------------------
2ajhB           -----------------GVEITFNVNDYD--NTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELA
2ajgB           -----------------GVEITFNVNDYD--NTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELA
3c8zA           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
2csxA           WGIPVPFDPEHTIYVWFD----------------------------------------------------
2dlcX           VDQRKIFVLAEENLPSLGY------------KKRAHLMNPMVPGLANSKIDLLEEPKQVKKKNSAFCSPG
2bvtA           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2c1fA           WAKQGWGIGNLYALNAEGWQSSGVAD----VTLLDVYTT-------------------------------
3dpgA           AVVVLPEEFQNDEMWREEIAGLTR----------------------------------------------
1d2rA           IPEARIPKVGARIMSLVDPTKKMSK-SDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKP---
2ag6A           GLDGEGKMSSSKGNFIAVDDSPEEI--RAKIKKAYCPNPIMEIAKYFLEYPLTIKRPEFGGDLTVNSYEE
3bicB           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2ct8A           KWGIPVPFDPEHWFDALFNYISALEDKVEIYWPADLHLVGKDILRFWPAFLMSLGYELPKKVF-------
3c5fA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1b80A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
2azxA           AIDQDPYFRTRDVAPRIGYPKPALLHST------------------------------------------
2bcqA           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2a6tA           DMTIRGQNVRLYIIPGISLDTRFEISKIENLMDLPTFKMKNKFYMVIPFLAPLKKWIKKRNIANN-----
3e3nA           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
3e3nD           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
1cjyB           ----------------------------------------------------------------------
3e3nH           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
2cfoA           WQDLVRGRVSWQGADLGGDMVRAAPRGEIGYPLYNLVVVVDDIAMGITDVIRGEDH--------------
2cybB           TPILVGLDGQKMSSSKGNYISVRDPPEEVERKIRKAYCPAGVV---------------------------
2cycA           ----------------------------------------------------------------------
2cfoB           WQDLVRGRVSWQGADLGGDMVIAAPRGEIGYPLYNLVVVVDDIAMGITD---------------------
2arlA           ----------------------------------------------------------------------
3bjqH           NADHKVKLVGSARWTSPDSDPTKDVETA--KEAIADSIGEPNRLLSRKALSACKYHPKLIEITIDLK---
3bjqE           KYNADHKVKLVGSARWTSPDSDPTKDVETAKEAIADSIGEPNRLLSRKALSACKYHPKLIERVKYTRAES
3ci0I           ----------------------------------------------------------------------
2e50B           --------------------------------------------------------------KEQQEAIE
2cybA           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2d26A           ----------------------------------------------------------------------
2akeA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FREECSKTGTTEESIASAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRDLDFA
2bteA           YVEAAKRKTEIERQAEGREKTGVFLGAYALNPAT-GERIPIWTADYVLFGYGTGAIMAVPAHDQRDYEFA
1c8kA           RDV-------AKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEP
2amvA           KQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKR-QLLNCLHVITLYNRIKKEPNKFVVPRTVMIG
1abbA           --------DVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEP
1axrA           FAAYLERE-------YKVHINPNSLFDVQVKRI-HEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIG
3bjqF           LKALWEVEEI-------------------------VVGTARVATDSFGDVWGPDVWLGYVSDNPDPSVEE
3e3nF           RDVAKVKQENK-------LKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEP
2c1wC           ----------------------------------------------------------------------
2d5bA           LIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGGPDGRKMSKTLGNVVDPFA---LLEKYGRDALRYYLLR
3bjqI           A------------------LWEVEEIVVGTAR------VATSFGDVWGPDVWLGYVSDNPDPSVEEPSFG
1a8hA           WHLIGKLKPHAVFWPTMLKAAGIPMYRHLNVGGFLLGKMSKTLGNVVDPFA-------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           AK------------------------DLQHVNFGMVQGMSTRKGTVVFLDN---ILEETKEKMHEVMKKN
2d54A           LIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGLGPDRKMSKTLGNVVDPFA-------------------
2ajgA           FIDECRNTKVAEAEMATMEKKGVDTGFKAVHPLT-GEEIPVWAANFVLMEYGTGAVMAVPGHDQRDYEFA
3c8zB           ----------------------------------------------------------------------
2ajhB           AFIDECRT---------MEKKGVDTGFKAVHPLT-GEEIPVWAANFVLMEYGTGAVMAVPGHDQRDYEFA
2ajgB           AFIDECRN----------EKKGVDTGFKAVHPLT-GEEIPVWAANFVLMEYGTGAVMAVPGHDQRDYEFA
3c8zA           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2dlcX           NVEENGLLSFVQYVIAPIQELFIDRPEKFGGPITYK-SFEEMKLAFKEEKLSPPDLKIGVADAINELLEP
2bvtA           -----------------------------IAIVDADTAETRSLLSYLDGVRGEGIL--FGHQHTTSFGLT
2aelA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ag6A           LESLFKNKE-------------------------------------------------------------
3bicB           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1b80A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
3e3nD           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
1cjyB           ----------------------------------------------------------------------
3e3nH           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3ecjA           ----------------------YLEDLGFRVTEDIQDDEGTTYAAWMHRKGTVHDTALTGGNGPRLHHVA
1bt1A           ----------------------------------------------------------------------
1ei5A           ---------------------------------------VLCGADPEGVFLPAQAQSLLRRLKTTHFEPG
2cfoA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3bjqH           ---------------ALWEVEEIVVGTARVATGN-DSFGDVWGPDV-----WLGYVSDNPDPSVEEPSFG
3bjqE           ITIDLKALWEVEEIVVG--------TARVA----TDSFGDVWGPDVWLGYVS-----DNPDPSVEEPSFG
3ci0I           ----------------------------------------------------------------------
2e50B           HIDEVQNIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEAM
2cybA           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2crqA           -----------------------------------------------------------SNIGQHDLDTK
2an2A           ----------------------------------------------------YAELGKAEEVADRLDSIK
1bdgA           ----------------------------------------------------------------------
2d26A           ----------------------------------------------------------------------
2akeA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2csxA           --------------------------------------------------YVNDVPHLGHAYTTIAADTI
2ag6A           ----------------------------------------------------------------------
2ct8A           --------------------------------------------------YVNDVPHLGHAYTTIAADTI
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KKYNLKITPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGLKVPSQSIIKTIEFLEKNNLGTKKTNYRLK
2bteA           RKFGLPIKKVIERPGEPLPEPLERAYEEPGIMVNSGPFDGTE-SEEGKRKVIAWLEEKGLGKGRVTYRLR
1c8kA           NKFVVPRT-VMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLE-NYRVSLAEKVIPAADL
2amvA           GKAAPGY----HMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLE----------NYRVSLAEKVIPAADL
1abbA           NKFVVPRT-VMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLEN-YRVSLAEKVIPAADL
1axrA           GKAAPGYHMA-------------KMIIKLITAIGDVVNHDPVV-GDRLRVIFLENYRVSLAEKVIPAADL
3bjqF           PSFGYTYQIEGHPLVE------VPYWDNNAKSWIYGVSDDNT---PALSGLAGYLIED------------
3e3nF           NKFVVPRTVMI-GGKAAPGYHMAKMIIKLITAIGDVVNHDPV-VGDRLRVIFLENYRVSLAEKVIPAADL
2c1wC           ----------------------------------------------------------------------
2d5bA           E---------------------------------------------------------------------
3bjqI           YTYQIEGHPLVEVPYWDNNKSWIYGVSDDNTPALSGLAGYL-----------------------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           ENKYAQI----------EHPEEVADLVGISAVM---IQDMQGKRINNYEFKWERMLSFE---GDTGPYLQ
2d54A           ----------------------------------------------------------------------
2ajgA           SKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDH-EAAFNAIADKLTAMGVGERK------
3c8zB           ----------------------------------------------------------------------
2ajhB           SKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDH-EAAFNAIADKLTAMGVGERK------
2ajgB           SKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDH-EAAFNAIADKLTAMGVGERK------
3c8zA           ----------------------------------------------------------------------
3bicA           ------------------ALAKKQLKGKNPEDLIWHTPEGISI-KPLYSKRDTMDLPEELPGVKPFTRGP
2csxA           ----------------------------------------------------------------------
2dlcX           IRQEFA----------------------------------------------------------------
2bvtA           TGPTDGTTSDVKNVT-----------------GDFPAVFGWDTL-IIEGNERPGLAENTRDENIALRKAD
2aelA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
3bicB           ------------------ALAKKQLKGKNPEDLIWHTPEGISIKPLYSKRDTM-DLPEELPGVKPFTRGP
3dl5B           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1b80A           -----------------------------------------------------------------ALSNC
2c1sA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
3e3nD           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
1cjyB           ---------------------------------------------------------------TLIHNRM
3e3nH           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3ecjA           FSTHEKHNIIQICDKMGALRISDRIERGPGRHGVSNAFYLYILDPDNHRIEIYTQDYYTGDPDNPTITWN
1bt1A           ----------------------------------------------------------------------
1ei5A           SHYSYCNGNFRI----LADLIEAHTGRTLVDILSERIFAPAGMKRAELISDTALFDECTGYEGDTVRGFL
2cfoA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3bjqH           YTYQIEGHPLVEVPYWDNNSWIYPALSGLGYLIEDAGLPA------------------------------
3bjqE           YTYQIEGHPLVEVPDNNAKSWIYGVSDD------------------------------------------
3ci0I           ----------------------------------------------------------------------
2e50B           HYLTRVEVTEFED--------------------IKSGYRIDFY-FDENPYFENKVLSKEFHMSSKSTEIK
2cybA           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2crqA           SKQIQQW--------IEKKYHVQVTIKRRK----DAEQSEEET-EEIFNQILQTMPDIATF----SSRPK
2an2A           SSYVHTKEEKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEDVR--DALFHHIETATNNKIRPSITIFPPE
1bdgA           ----------------------------------------------------------------------
2d26A           ----------------------------------------------------------------------
2akeA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2csxA           ARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAFKKLWEFLKIEYTKFIRTTDPYHVKFV
2ag6A           ----------------------------------------------------------------------
2ct8A           ARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAERFKKIEYTKFIRTTDPYHVKFVQKVF
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DWGISRQRYWGCPIPIAYDENDQPIKIPRDMLPVKLPEIEKLSNTGNPLDSEDNWKFFILDGKKYRRETD
2bteA           DWLISRQRYWGTPIPMVHCEACGVVPVPEEELPVLLPDLKDVEDGKSPLEAHPEFYECPKCGGPAKRDTD
1c8kA           SEQISTAGTEASGTGNMKFMLNGALTIGTMDGA--NVEMAEEAGEENF-----------FIFGMRVEDVD
2amvA           SEQISTAGTEASGTGNMKFMLNGALTIGT--------------------MDGANVEMAEEAGEENFFIFG
1abbA           SEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEA---GEENFFIFGMRVEDVDRLDQRGYNAQ
1axrA           SEQISTAGTEASGTGNMKFMLNGALTIGT-------------MDGANVEMAEEAGEENFFIFGMRVEDVD
3bjqF           ----------------------------------------------------------------------
3e3nF           SEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYD
2c1wC           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           YAHSRLRSVERNASGITQEKWI------------------------------------------------
2d54A           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3bicA           YPTMYTFRPWTIRQYAGFSTVEESNKFYKDNIKQQGL---------------SVAFDLATHRGYDSDNPR
2csxA           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
2bvtA           AIGGVNTVSAHVENFVTGGSFYDTSGDTLRAVLPLADASRRDDGTLIPIAAYGSPGEYQ-ELYRFTVEYL
2aelA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
3bicB           YPTMYTFRPWTIRQYAGFSTVEESNKFYKDNIKQQGL---------------SVAFDLATHRGYDSDNPR
3dl5B           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1b80A           PGAPQMNFFTGRAPATQPAPDGL-VPEPFHTVDQIINRVNDAGEFDLVMLSAHSVAAVNDVTVQGLPFDS
2c1sA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3cglD           -------------------------------MLIDLHLEGTFNGHYFEIKGKGKGQPNENTVTLEVTKGG
3e3nB           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3cglC           ---------------------------IKEEMLIDLHLEGTFNGHYFEIKGKGQPNEGTNTVTLEVTKGG
1a1xA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
3e3nD           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
1cjyB           NTTLSSLKEKVNTLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFMAPDLFGSKFFMGTVVKKYE
3e3nH           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3ecjA           VHDNQRRDWWGNPVVPSWYTEASKVLDLDGNVQEIILRTDD----------SELEVTIGADGFSFTRAGD
1bt1A           ------------PIQAPEISKCVVP-------PADLPPGAVVDNCCPPVASNIVDYKLPAVTMKVRPAAH
1ei5A           PATNRIQWMGDAGICASLNDMIAWEQFIDATRDDESGLYRRLSGPQTFKDGVAAPYGFGLNLHETGGKRL
2cfoA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2arlA           ---------------------------------------------GKPYEGEQTVKLTVTKGGPLPFAWD
3bjqH           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
2e50B           WK-------SGKDMFF------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2crqA           AIRGGTA--SMCVFHLSKKE--------------------------------------------------
2an2A           EKGEKQVEIWNHQLIRYAGYEGEAIGDPASCSLTAACEQLGWRGERTDFDLLPLIFRMKGDEQPVWYELP
1bdgA           ----------------------------------------------------------------------
2d26A           ----------------------------------------------------------------------
2akeA           ----------------------------------------------------------------------
2d5bA           ---------------QEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRVPWGI---PLPWDENH
3c8zB           ------------------------------------------------------PGKSDQLDALLWRAER
3c8zA           ---LASGAAYIVEDAEYPDVYFRADATAQFGYESGYDRDTMLTLFAERGGDPDRPGKSDQLDALLWRAER
2csxA           QKVFEECYKRGDIYLGEYKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRP
2ag6A           ----------------------------------------------------------------------
2ct8A           EECYKRGDIYLGEYEKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNSFVKQGLKDLSVTRPRSRVKW
3d6vA           -----------------------------------------------MLDKDYTLNVYRL---ALKTTLK
2cybB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           TLDTFVDSSWYFLRFCSPHNLDRGFTQEEANYWMPVDQYIGGVEHAILHLLYSRFFMQALSYKNDDFKLK
2bteA           TMDTFFDSSWYYLRYTDPHNDRLPFDPEKANAWMPVDQYIGGVEHAVLHLLYSRFFTKFLH-DLGMVKVE
1c8kA           RLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLF-----KDIVNMLMHHDRFKVFADYEEYVKCQ
2amvA           MRVEDVDRLDQRGYNAQEYY-DRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEY
1abbA           EYYDRIPELRQIIEQLS----SGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYV--------------
1axrA           RLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLF-----KDIVNMLMHHDRFKVFADYEEYVKCQ
3bjqF           ----------------------------------------------------------------------
3e3nF           RIPELRQIIEQLSSGFFSPKQPDLFKD-IVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPRTRMVIRN
2c1wC           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3bicA           VRGDVGMAGV---------------------AIDTVEDTKILFDGIPLEKMSVSMTM------------N
2csxA           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
2bvtA           RDVKGVSNLYAWGPGGGFGGNR-----DVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVADLRMIAEI
2aelA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
3bicB           VRGDVGMAGVAI--------------------------DTVEDTKILFDGIPLEKMSVSM-------TMN
3dl5B           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1b80A           TPGIFDSQFFVETQLRGTAFPGSGGNQGEVEIRIQSDHARDSRTACEWQSFVNN---------------Q
2c1sA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3cglD           PLPFGWHILCPQFNKAFVHHPDN-IHDYLKLSFPEGYTWERSMHFEDGGLCCITNDISLTG--------N
3e3nB           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3cglC           PLPFGWHPQFNKAFVHHPDNIHDYL----KLSFPEGYTWERSMHFEDGGLCCITNDISLTG--------N
1a1xA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
3e3nD           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
1cjyB           ENPLFLMGVWGSAFSILFNR-----VLGSTMEEELENITTKHIVSWIHRMIMALVSDSAL-------FNT
3e3nH           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3ecjA           EDGSYHGQASKGF---------------------------------------------------------
1bt1A           TMDKD-AIAKFAKAVELMKALPADCAYCNGGYDQVNFPDQNSWLFFPFHRWYLYFYLGKLIGDPSFGLPF
1ei5A           TGHGGALRGWRCQRWHCADERLSTIAMFNFEGGASEVAFKLMNIALGVSSSEVSRVEADSAWFGSWLDDE
2cfoA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2arlA           ILSPQ--CSIPFTKYPED-------IPDYVKQSFPEGFTWERIM-----NFEDGAVCTVS--NDSSIQGN
3bjqH           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
2an2A           R-SLVIEVPITHPD------IEAFSDLELKWYGVPIKLEVGGIHY-------------------------
1bdgA           ----------------------------------------------------------------------
2d26A           ----------------------------------------------------------------------
2akeA           ----------------------------------------------------------------------
2d5bA           VTFVWFDALLNYVSALDYPEGEA------YRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIP-------
3c8zB           PGEPSWPSPFGRGRPGWHVEC---SAIALTRIGTGLDIQGGGSDLIFPHHEYSAAHAESVTGER------
3c8zA           PGEPSWPSPFGRGRPGWHVEC---SAIALTRIGTGLDIQGGGSDLIFPHHEYSAAHAESVTGE-------
2csxA           RSRVPFDPEHTIYVWFDALFNYISALEDKVEIYWPADLHLVGKDILRFHTVYWPAFLMSLGY--------
2ag6A           ----------------------------------------------------------------------
2ct8A           GIPVPFDPEHTIYVWFDALFNYISALEDKVEIYWPADLHLVGKDILRFHTVYWPAFLMS--------LGY
3d6vA           RARRSMELIAREDENPKVAEVIYPIMQVNPLHYEGVDVAVGGMEQRKIHMLAREL-------------LP
2cybB           ----SMDEVSRRKEDPMVSQMIYPLMQALDIAHLGVDLAVGGIDQRKIHMLARENLP----------RLG


                         .         .         .         *         .         .         .:630
query           EPFDGLFTQGMVCHETYKDQNNKWLSPDEVTSEDGKKFYKKDNPSEKIIVGPTESMSKSKKNTIDPENII
2bteA           EPFQGLFTQGMVLAWTDFGPVEVEGSVVRLPEPTRIRLELRPHEDGTLHLWKPAVMSKSKGNGVMVGPFV
1c8kA           ERVSALYKNPREWTRMVNIATSGKFSSDRTIAQYAREIWGVEPSRQRLP---------------------
2amvA           VKCQERVSALYKNPREWTRMVIRNIATSGKFSSDRT-------------------IAQYAREGVEPSRQ-
1abbA           ----------------------------------------------------------------------
1axrA           ERVSALYKNPREWTRMVIRATSGKFSSDRTIAQYAREIWGVEPSRQRLP---------------------
3bjqF           ----------------------------------------------------------------------
3e3nF           IATSGKFSSDRTIAQYARE---------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3bicA           GAVIPVLANFIV---------------------------------------------TGEEQGVPKEKLT
2csxA           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
2bvtA           ADEKGKVS---------------------AFTEFGVSGGVGTNGSSP--AQWFTKVLAAIKADPVASRNA
2aelA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
3bicB           GAVIPVLANFIVT---------------------------------------------GEEQGVPKEKLT
3dl5B           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1b80A           SKLVDDFQFIFL-----A------LTQLGQDPNAMTD------------------CSDVIPQSKPIPGNL
2c1sA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3cglD           CFYYDIKFTGLNFPP------------------NGPV------------------VQKKTTGWEPSTERL
3e3nB           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3cglC           CFYYDIKFTGLNFPP------------------NGPV------------------VQKKTTGWEPSTERL
1a1xA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
3e3nD           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
1cjyB           REGRAGKVHNFMLGLNDVKSKKIH-----------------------------VVDSGLTFNLPYPLILR
3e3nH           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
1bt1A           WNWDNPGGMVLPDFLNDSTSSLYDSNRNQSHLPP------------------------------------
1ei5A           TGLVLLEDAGHGRMKARFGTSPEMMDVVSANEARVTTIRRDGETIELVRASENLRLSMKRVKGEAKHDII
2cfoA           -----------------------------------------------------QKLSKRDGVTSISDFRA
2cybB           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
2cfoB           -------------------------------------------------------LSKRDGVTSISDFRA
2arlA           CFTYHVKFSGLNFPP------------------NGPV------------------MQKKTQGWEPSSERL
3bjqH           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2ab5B           -------------------------------------------------------ISKKGKYLLYELGIE
3c98A           ------LSMRMLSCCKMTDIMTEGITIVEDI--NKRREPLPSLEAVYLITPSEKSVHSLISDFKDP----
2crqA           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2d26A           ----------------------------------------------------------------------
2akeA           ----------------------------------------------------------------------
2d5bA           -MYRHLNVGGFLLGP------------------DGRK------------------MSKTLGNVVDPFALL
3c8zB           -RFARHYVHTGMIGVLVSQ------------------------------------LR------------A
3c8zA           RRFARHYVHTGMIGVLVSQL------------------------------------------------RA
2csxA           -------------------------------------ELPKKVFAHGWWTVEGKKMSKTLGNVVDPYEVV
2ag6A           ----------------------------MLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDSP
2ct8A           ELPKKVFAHGWWTVEGKK-------------------------------------MSKTLGNVVDPYEVV
3d6vA           KKVVCIHNPVL-------------------TGLDGEGKMSSSKGNFIAVDDSPEEIRAK----------I
2cybB           YSSPVCLHTPIL------------------VGLDGQK------------------MSSSKGNYISVRDPP


                         .         +         .         .         .         .         *:700
query           KNYGADSVRLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLNSKILDKIKNNDQGSEGNDLAKFTNQLI
2bteA           KEQGADIARITILFAAPPENEMVWTEEGVQGAWRFLNRIYRRVAEDREALLETSGVFQAEALYGKLHETL
1c8kA           ----------------------------------------------------------------------
2amvA           ----------------------------------------------------------------------
1abbA           ----------------------------------------------------------------------
1axrA           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
3e3nF           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3bicA           GTIQNDILKEFMVRNTYIF-PPEPSMKIIADIFEYTAKHMKFNSISISGYHMQEAGADAILELAYTLADG
2csxA           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
2bvtA           YMANFDAGQHFVPVPGDAL-LEDFQAYAADPFTLFASEVTGA----------------------------
2aelA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
3bicB           GTIQNDILKEFMVRNTYIF-PPEPSMKIIADIFEYTAKHMKFNSISISGYHMQEAGADAILELAYTLADG
3dl5B           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1b80A           PFSFFPAG------KTIKDVEQACAE--------------------------------------------
2c1sA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3cglD           YPRDGVLIGDIHHALTVEGGGHYACD--IKTVYRAKKAALKMPGYHYVDTKLVIWNNDKEFMKVEEHEIA
3e3nB           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3cglC           YPRDGVLIGDIHHALTVEGGGHYACD--IKTVYRAKKAALKMPGYHYVDTKLVIWNNDKEFMKVEEHEIA
1a1xA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
3e3nD           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
1cjyB           PQRGVDLIISFDFSARPSDSSPPF--KELLLAEKWAKMNKLPFPKIDPYVFDREGLKECYVFKPDCPTII
3e3nH           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
1ei5A           GRYHSDELDADLLLVSEGGAIYGAFEGFLGKSDMYPLYSVGSDVWLLPVQRSMDAPSPGEWKLVFRRDDK
2cfoA           MGYLAPALANYMTLLGWSPPEGVGELFTLDLAAKHF---------SFERINKAGARFDWDKLNWLNRQYI
2cybB           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
2cfoB           MGYLAPALANYMTLLGWSPPEGVGELDLAAKHFSFERINKAGARFDWDKLNWLNRQLEPEEFLAELIPLW
2arlA           FARGGMLIGNNFMALKLEGGGHYLC--EFKTTYKAKKPVKMPGYHYVDRKLDVTNHNKDYTSVE------
3bjqH           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2ab5B           HIRDIQLLYKIKLKKDGTIKECKFNVRNKNHLKNIIIPIFNKHYDYLYFKDNLLKDIKYYNDLSYYLRPI
3c98A           --PTAKYRAAHVFFTDSCPDALELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSEQIATLCAT
2crqA           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2d26A           ----------------------------------------------------------------------
2akeA           ----------------------------------------------------------------------
2d5bA           EKYGRDALRYYLLREIPYGQDTPVSEEALRTRYDLADDLGNLVQRTRAMLFRFAEGRIGEELAEGTG-LA
3c8zB           QGVDPSAIRLGLFS-GHYREDRFWSNEVLDEANARLARWRSATALPEAPDATDVIARVRQYLADDLDGWC
3c8zA           QGVDPSAIRLGLFS-GHYREDRFWSNEVLDEANARLARWRSAEAPDATDVIARVRQYLADDLDTPKDGWC
2csxA           QEYGLDEVRYFLLREVPFGQDGDFSKKAILNRIELANEIGNLYSRVVNMAHKFLGGEVSGAYAKIAQESI
2ag6A           EEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRPEKFGGDLTVN---------------------
2ct8A           QEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINLANEIGNLYSRVVNMAHKFLGGARDEEYAKIAQESI
3d6vA           KKAYCPAGVVEGNPIMEIAKYFLEYPLTI---KRPEKFGGDLTVNSYEELESLFKNKELHP-MDLKNAVA
2cybB           EEVERKIRKAYCPAVVEENPILDIAKYHILPRFGKIVVERDAGDVEYASFEELAEDFKSGQLHDLKIAVA


                         .         .         .         .         +         .         .:770
query           NKITQNLEKFHYNVIVANFYEMYNFLXXXXXXXXXXXXXXXNYKKILIVMNPFIPHFSNECLSTINENQI
2bteA           KKVTEDLEALRFNTAIAALMEFLNALYEYRKDRPVTPVYRTAIRYYLQMLFPFAPHLAEELWHWFWPDSL
1c8kA           ----------------------------------------------------------------------
2amvA           ----------------------------------------------------------------------
1abbA           ----------------------------------------------------------------------
1axrA           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
3e3nF           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3bicA           LEYSRTGLQLTIDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHEQDPYNNIVRTAIEAMAAVFGGTQN
2csxA           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
3bicB           LEYSRTGLQLTIDEFAPRLSFFWGIG--------------------------------------------
3dl5B           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1b80A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3cglD           VARHHPFYE-------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3cglC           VARHHPFYE-------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
3e3nD           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
1cjyB           HFVLANINFRKYAPGVPRETEEEKEI--------------------------------------------
3e3nH           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
1ei5A           GEITGLSVGCWL-------ARGVEY---------------------------------------------
2cfoA           QQLEPEFLAELIPLWQGAGYAFDEERDRP-------------WLFDLAQLLQPGLNTLREAIDQGAVFFI
2cybB           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
2cfoB           QGAGYAFDEERDRPWLFDLAQLL----------------------------QPGLNTLREAIDQGAVFFI
2arlA           ----------------------------------------------------------------------
3bjqH           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2ab5B           KPFNTTEDILNKNYFSSWLIGFFEAKSCFSIYKKTASFEVSNNNEVLAIKSYL--KINNNIYNEFN-NSK
3c98A           LKEYPAVRYRGEYKDNALLAQLIQYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELMSYDLLPIEN
2crqA           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2d26A           ----------------------------------------------------------------------
2akeA           ----------------------------------------------------------------------
2d5bA           GRLRPLVRELKFHVALEEAMAYVKALNRYINEKKPWELFKKELRIASILLTPAMPDKMAELRRALGLKEE
3c8zB           TDALSYGGHDTESPRLVATT--------------------------------------------------
3c8zA           TDALSYGGHDTESPRLVATT--------------------------------------------------
2csxA           KNYENYMEKVNFYKAIEEILKFTSYLNKYVDEKQPWALNKERKFVLTHLLYPITPNKMKEALQMLGLKEL
2ag6A           ----------------------------------------------------------------------
2ct8A           KNYENYMEKVNFYKAIEEILKFTSYLNKYVDEKQPWALNKERKFVLTHLLYPITPNKMKEALQMLGEKEL
3d6vA           EELIKILE--------------------------------------------------------------
2cybB           KYLNMLLEDAR-----------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           SWPEISKEDLIEEDINFVVQINGKKRAILKIKRDVVEKEILEIIKTNLEIEKFLKDKTIKKSIFVPNRLI
2bteA           GWPELDEKALEKDVVEVAVQVNGRVRGTIHIPKDAPLEVARAEALKVRNVRAHLEGKEVVKEIYVPGKIL
1c8kA           ----------------------------------------------------------------------
2amvA           ----------------------------------------------------------------------
1abbA           ----------------------------------------------------------------------
1axrA           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
3e3nF           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3bicA           SFDEALGLPTVKSARIARNTQIIIQEESGIPK--------------------------------------
2csxA           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
3bicB           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1b80A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
3e3nD           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
1cjyB           ----------------------------------------------------------------------
3e3nH           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
2cfoA           PSVTFDSEAMAQLGQPQSATILAYLLEHLPAEPALTVAMGQQLIQ-------------------------
2cybB           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
2cfoB           PSVTFDSEAMAQLGQPQSATILAYLLEHLPAEPALTVAMGQQLIQ-------------------------
2arlA           ----------------------------------------------------------------------
3bjqH           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2ab5B           TTKSINDIKNVVFINNNPIKLLGYKK--------------------------------------------
3c98A           DVYKYETSGIGEARVKEVLDDDLWIALRHKHIAEVSQEVTRSLKDFSSSKRMMRDLSQMLKKMPQYQKEL
2crqA           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2d26A           ----------------------------------------------------------------------
2akeA           ----------------------------------------------------------------------
2d5bA           RWGLA-EPRPIPEEA-------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2csxA           KPYSKNTYKLGERKILFPK---------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2ct8A           KPYSKNTYKLGERKILFPK---------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           NIIL
2bteA           NLVV
1c8kA           ----
2amvA           ----
1abbA           ----
1axrA           ----
3bjqF           ----
3e3nF           ----
2c1wC           ----
2d5bA           ----
3bjqI           ----
1a8hA           ----
2c1wB           ----
1bs2A           ----
2d54A           ----
2ajgA           ----
3c8zB           ----
2ajhB           ----
2ajgB           ----
3c8zA           ----
3bicA           ----
2csxA           ----
2dlcX           ----
2bvtA           ----
2aelA           ----
3egbB           ----
2aelB           ----
2bcvA           ----
2c1fA           ----
3dpgA           ----
1d2rA           ----
2ag6A           ----
3bicB           ----
3dl5B           ----
2ct8A           ----
3c5fA           ----
2aekA           ----
1b80A           ----
2c1sA           ----
2bcrA           ----
3cglD           ----
3e3nB           ----
2azxA           ----
2bcqA           ----
3cglC           ----
1a1xA           ----
2a6tA           ----
3e3nA           ----
3d6uA           ----
3e3nD           ----
3d6vA           ----
1cjyB           ----
3e3nH           ----
1b25A           ----
3cfiJ           ----
2c1qA           ----
3ecjA           ----
1bt1A           ----
1ei5A           ----
2cfoA           ----
2cybB           ----
2cycA           ----
2cfoB           ----
2arlA           ----
3bjqH           ----
3bjqE           ----
3ci0I           ----
2e50B           ----
2cybA           ----
2ab5B           ----
3c98A           SKY-
2crqA           ----
2an2A           ----
1bdgA           ----
2d26A           ----
2akeA           ----
2d5bA           ----
3c8zB           ----
3c8zA           ----
2csxA           ----
2ag6A           ----
2ct8A           ----
3d6vA           ----
2cybB           ----