[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21236.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2e9fD.bssp"
#ERROR : Can't open dsspfile "2e9fC.bssp"
#ERROR : Can't open dsspfile "2e9fA.bssp"
#ERROR : Can't open dsspfile "2e9fB.bssp"
#ERROR : Can't open dsspfile "1auwA.bssp"
#ERROR : Can't open dsspfile "1dcnB.bssp"
#ERROR : Can't open dsspfile "1dcnA.bssp"
#ERROR : Can't open dsspfile "3c8tA.bssp"
#ERROR : Can't open dsspfile "1aosA.bssp"
#ERROR : Can't open dsspfile "1c3cA.bssp"
#ERROR : Can't open dsspfile "1dcnD.bssp"
#ERROR : Can't open dsspfile "1c3uA.bssp"
#ERROR : Can't open dsspfile "3e04D.bssp"
#ERROR : Can't open dsspfile "3e04B.bssp"
#ERROR : Can't open dsspfile "3e04A.bssp"
#ERROR : Can't open dsspfile "1dofA.bssp"
#ERROR : Can't open dsspfile "3bhgA.bssp"
#ERROR : Can't open dsspfile "1dcnC.bssp"
#ERROR : Can't open dsspfile "3e04C.bssp"
#ERROR : Can't open dsspfile "2d05A.bssp"
#ERROR : Can't open dsspfile "1eboA.bssp"
#ERROR : Can't open dsspfile "1eboF.bssp"
#ERROR : Can't open dsspfile "1eboC.bssp"
#ERROR : Can't open dsspfile "3bboD.bssp"

## Summary of PDB Search
:462
    e-106  37%  2e9fD  [x.x.x] ARGININOSUCCINATE LYASE
    e-105  37%  2e9fC  [x.x.x] ARGININOSUCCINATE LYASE
    e-104  38%  2e9fA  [x.x.x] ARGININOSUCCINATE LYASE
    e-103  37%  2e9fB  [x.x.x] ARGININOSUCCINATE LYASE
    7e-99  36%  1auwA  [a.127.1] DELTA 2 CRYSTALLIN
    3e-87  34%  1dcnB  [a.127.1] DELTA 2 CRYSTALLIN
    4e-84  34%  1dcnA  [a.127.1] DELTA 2 CRYSTALLIN
    2e-82  13%  3c8tA  [x.x.x] FUMARATE LYASE
    2e-82  34%  1aosA  [a.127.1] ARGININOSUCCINATE LYASE
    1e-81  16%  1c3cA  [a.127.1] PROTEIN (ADENYLOSUCCINATE LYASE)
    1e-78  34%  1dcnD  [a.127.1] DELTA 2 CRYSTALLIN
    2e-77  17%  1c3uA  [a.127.1] ADENYLOSUCCINATE LYASE
    5e-76  14%  3e04D  [x.x.x] FUMARATE HYDRATASE
    2e-75  16%  3e04B  [x.x.x] FUMARATE HYDRATASE
    2e-74  15%  3e04A  [x.x.x] FUMARATE HYDRATASE
    2e-73  14%  1dofA  [a.127.1] ADENYLOSUCCINATE LYASE
    3e-73  12%  3bhgA  [x.x.x] ADENYLOSUCCINATE LYASE
    4e-72  33%  1dcnC  [a.127.1] DELTA 2 CRYSTALLIN
    1e-71  16%  3e04C  [x.x.x] FUMARATE HYDRATASE
    1e-26   9%  2d05A  [x.x.x] CHITOSANASE
    2e-22  15%  1eboA  [h.3.2] EBOLA VIRUS ENVELOPE PROTEIN CHIMERA CONSISTING
    6e-21  12%  1eboF  [h.3.2] EBOLA VIRUS ENVELOPE PROTEIN CHIMERA CONSISTING
    2e-19  12%  1eboC  [h.3.2] EBOLA VIRUS ENVELOPE PROTEIN CHIMERA CONSISTING
    4e-13  16%  3bboD  [x.x.x] RIBOSOMAL PROTEIN L1
:462

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxNNMAIWGSRIKKDASTLFQKVGNSIDIDKKLFQEDILGSIAHVEMLFRQXXXXXXXXXXXXXGLN
2e9fD           ------------------PDALAARFNASLAFDRALWREDLWQNRVHARMLHAVGLLSAEELEAILKGLD
2e9fC           -------------------DALAARFNASLAFDRALWREDLWQNRVHARMLHAVGLLSAEELEAILKGLD
2e9fA           ----------------------------SLAFDRALWREDLWQNRVHARMLHAVGLLSAEELEAILKGLD
2e9fB           ------------------PDALAARFNASLAFDRALWREDLWQNRVHARMLHAVGLLSAEELEAILKGLD
1auwA           ----------------------------SIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1dcnB           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1dcnA           --------------------------------DQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
3c8tA           ----------------------------ELFSAQSFISRCVETEVALARAQARLGIIPEDAAAGITAAAR
1aosA           ----------------------------SIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLD
1c3cA           ----------------------------DLWTEEAKYRRWLEVELAVTRAYEELGMIPKGVTERIRNNAK
1dcnD           --------------------------NSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1c3uA           ----------------------------DLWTEEAKYRRWLEVELAVTRAYEELGMIPKGVTERIRNNAK
3e04D           ---------PNDKYYGAQTVRSTMNFKIGGVTERMVIKAFGILKRAAAEVNQDYGLDPKIANAIMK-AAD
3e04B           --------KYYGAQTVR-STMNFKIGGVTERMPTPVIKAFGILKRAAAEVN-QDYGLDPKIANAIMKAAD
3e04A           --------KYYGAQTVR-STMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMK-AAD
1dofA           ----------------------------RLFTNEAIINAYLEVERALVCALEE---------------LG
3bhgA           -----ALNAIIDGRYVNKTRALSPYFSEFALTYYRLVEIKWFESLAANDTIPEVPALDNKARKFLSDLIS
1dcnC           ----------------------------SIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
3e04C           --------KYYGAQTVRSTM-NFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMK-AAD
2d05A           ----------------------------------------------------------------------
1eboA           ----------------------------------------------------------------------
1eboF           ----------------------------------------------------------------------
1eboC           ----------------------------------------------------------------------
3bboD           ----------AGADIVGGEELIEQIKGGFMDFDKLIATSDMMAKVASLRILGPRGLMPTPKAGTVTPNVA


                         .         .         *         .         .         .         .:140
query           KIEKEILKNKFEYNKKYEDIHMNIEKRLFQIIGEEAGYVHTARSRNDQVITDFKMWTTSATKEINKNLDN
2e9fD           RIEEEIEAGTFPWREELEDVHMNLEARLTELVGPPGGKLHTARSRNDQVATDLRLYLRGAIDELLALLLA
2e9fC           RIEEEIEAGTFPWREELEDVHMNLEARLTELVGPPGGKLHTARSRNDQVATDLRLYLRGAIDELLALLLA
2e9fA           RIEEEIEAGTFPWREELEDVHMNLEARLTELVGPPGGKLHTARSRNDQVATDLRLYLRGAIDELLALLLA
2e9fB           RIEEEIEAGTFPWREELEDVHMNLEARLTELVGPPGGKLHTARSRNDQVATDLRLYLRGAIDELLALLLA
1auwA           KISEEWSKGVFVVKQSDEDINTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1dcnB           KIS-------------EEDIHTANERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1dcnA           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
3c8tA           TFAPEMERLRDDTEIVGYPILPLVE-QLSAHAGEAGKYLHWGATTQDIMDTATVLQIRDGLALISRRIES
1aosA           KVKLNS---------NDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWE
1c3cA           IDVELF----KKIEEKTNHDVVAFVEGIGSMIGEDSRFFHYGLTSSDVLDTANSLALVEAGKILLESLKE
1dcnD           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1c3uA           IDVELFKKIEEKTN---HDVVAFVE-GIGSMIGEDSRFFHYGLTSSDVLDTANSLALVEAGKILLESLKE
3e04D           EVAEGKLNDHFPLVVWNMNVNEVISNRAIEMLGGENDHVNKSQSSNDTFPTAMHIAAAIEVHEVLPGLQK
3e04B           EVAEGKLNDHFSGTQTNMNVNEVISNRAIEMLGGENDHVNKSQSSNDTFPTAMHIAAAIEVHEVLPGLQK
3e04A           EVAEGKLNDHFPLVVWNMNVNEVISNRAIEMLGGENDHVNKSQSSNDTFPTAMHIAAAIEVHEVLPGLQK
1dofA           VAERGCCEKVNKASVSADEVHDILSLVLLLEQKSGCRYVHYGATSNDIIDTAWALLIRRALAAVKEKARA
3bhgA           NFNESEAEKIKEFEKQTNHDVKQDKFQENEQLKSCVAFIHFACTSEDINNLAYALIKQAI-AQVIQPTIA
1dcnC           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
3e04C           EVAEGKLNDHFSGTQTNMNVNEVISNRAIEMLGGENDHVNKSQSSNDTFPTAMHIAAAIEVHEVLPGLQK
2d05A           --------------------------------------------------------------FSPETLQF
1eboA           QIEDKIEEIL------SKIYHINEIARIKKLIGEADGLIEGLRQLANETTQALQLFLRATTETFSILNRK
1eboF           ----------------SKIYHIENEIARIKLIGEADGLIEGLRQLANETTQALQLFLRATTELRTILNRK
1eboC           -----------------KIYHIENEIARIKLIGEADGLIEGLRQLANETTQALQLFLRATTELRTILNRK
3bboD           QAVEEFKKGKVEFRVDKTGIVHIPFGKLNFEEEDLLKSVETNKPTGAKGVYWKSAHISS-----------


                         +         .         .         .         .         *         .:210
query           IIKTILKISEKNIETIMPGFTHLKNAQAVSFAHYLMSYVEMFNRDKKRFTYNLESLSENPLGVAALTGTS
2e9fD           LRRVLVREAELDPLYVLPGYTHLQRAQPVLLAHWFLAYYEMLKRDAGRLEDAKERLNESPLGAAALAGTG
2e9fC           LRRVLVREAELDPLYVLPGYTHLQRAQPVLLAHWFLAYYEMLKRDAGRLEDAKERLNESPLGAAALAGTG
2e9fA           LRRVLVREAELDPLYVLPGYTHLQRAQPVLLAHWFLAYYEMLKRDAGRLEDAKERLNESPLGAAALAGTG
2e9fB           LRRVLVREAELDPLYVLPGYTHLQRAQPVLLAHWFLAYYEMLKRDAGRLEDAKERLNESPLGAAALAGTG
1auwA           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1dcnB           LIKTLVERAAIEIDVILPGYTNLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1dcnA           LIKTLVERAAIEIDVILPGYTNLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
3c8tA           VRKALAALARNHRDTPMAGRTHLQHALPVTFGYKAAVWLSAFDRHAARLEEISPRVLVVEFSGASGTLAS
1aosA           LIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNP
1c3cA           FCDVLWEVANRYKHTPTIGRTHGVHAEPTSFGLKVLGWYSEMKRNVQRLERAIEEVSYGKIS--GAVGNY
1dcnD           LIKTLVERAAIEIDVILPGYTNLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1c3uA           FCDVLWEVANRYKHTPTIGRTHGVHAEPTSFGLKVLGWYSEMKRNVQRLERAIEEVSYGKIS--GAVGNY
3e04D           LHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVLNTR
3e04B           LHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGNTR
3e04A           LHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELATGLNTRIGFA
1dofA           VGDQLASMARKYKTLEMVGRTHGQWAEPITLGFKFANYYYELYIACRQLALAEEFIRAKIGGTMASWGEL
3bhgA           EIGSITLLGKQH-ADVALSRTHGQPATPT-TGKELVNFVARLKRPQQQLAEVLIPAKFNAVGNYNAHVAA
1dcnC           LIKTLVERAAIEIDVILPGYTNLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
3e04C           LHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGNTR
2d05A           LRNNTGLDGEQWNNIMKLINKPEQDDLNWIKYY---GYCEDIEDERGYTI---------GLFGATT-GGS
1eboA           AIDFLLQRWGGTCHILGPDCR----IEPHDWTKNITDKIDQIIHDFVD----------------------
1eboF           AIDFLLQRWGGTCHILGPDCR----IEPHDWTKNITDKIDQIIHDFVD----------------------
1eboC           AIDFLLQRWGGTCHILGPDCR----IEPHDWTKNITDKIDQIIHDFV-----------------------
3bboD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FNIDRNFTSKKLGFKRPTNNSIDTVADRDFVLDFLYSASVCSMHISRIAEELIIWNSDGFNLITLSDKVV
2e9fD           FPIDRHFTARELGFKAPMRNSLDAVASRDFALEVLSALNIGMLHLSRMAEELILYSTEEFGFVEVPDAFA
2e9fC           FPIDRHFTARELGFKAPMRNSLDAVASRDFALEVLSALNIGMLHLSRMAEELILYSTEEFGFVEVPDAFA
2e9fA           FPIDRHFTARELGFKAPMRNSLDAVASRDFALEVLSALNIGMLHLSRMAEELILYSTEEFGFVEVPDAFA
2e9fB           FPIDRHFTARELGFKAPMRNSLDAVASRDFALEVLSALNIGMLHLSRMAEELILYSTEEFGFVEVPDAFA
1auwA           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTDSDAFS
1dcnB           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYST-------------
1dcnA           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSD---
3c8tA           LGTRGLDVQRELARENLGVPSITWHSARDAVAETVQFLALVSGSLGKLAMDISIMMT-------------
1aosA           LGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWRSLCMTHLSRMAEDLILYCTKEFSFVQLSDAYS
1c3cA           ANVPPEVEEKALSYLGLKPEPVSTVVPRDRHAFYLSTLAIVAAGIERIAVEIRHLQRTEVLEVEEPF---
1dcnD           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSD---
1c3uA           ANVPPEVEEKALSYLGLKPEPVSTVVPRDRHAFYLSTLAIVAAGIERIAVEIRHLQRTEVLEVEEPF---
3e04D           IGFAEKVAAKVAALFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPSGLGELILP--
3e04B           IGFAEKVAAKVAALFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLLILPENE
3e04A           EKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELI---
1dofA           GLEVRRRVAERLGL--PHHVITTQVAPRESFAVLASALALMAAVFERLAVEIRELSRPE-----------
3bhgA           YEVDWRKHCANFVLGLSFNAYTTQIEPHDGIAEVSQIVRINNILLDYTQDIWSYISLGYFK---------
1dcnC           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFL-------
3e04C           IGFAEKVAAKVAALTVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLLILPENE
2d05A           RDTHPDGPDLFKAYDAAKGASNPSADGALKRLGINGKMKGSILEIKDSEKVFCIKKLQNDAAWRKAMWET
1eboA           ----------------------------------------------------------------------
1eboF           ----------------------------------------------------------------------
1eboC           ----------------------------------------------------------------------
3bboD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TGSSIMPQKKNPDLLEYLRGKTGTVYGNLFSMLTILKGLPISYFKDLQDDKEILFKSNEILNNSIAILNE
2e9fD           TGSSIMPQKKNPDILELIRAKAGRVLGAFVGLSAVVKGLPLAYNKDLQEDKEPLLDALATYRDSLRLLAA
2e9fC           TGSSIMPQKKNPDILELIRAKAGRVLGAFVGLSAVVKGLPLAYNKDLQEDKEPLLDALATYRDSLRLLAA
2e9fA           TGSSIMPQKKNPDILELIRAKAGRVLGAFVGLSAVVKGLPLAYNKDLQEDKEPLLDALATYRDSLRLLAA
2e9fB           TGSSIMPQKKNPDILELIRAKAGRVLGAFVGLSAVVKGLPLAYNKDLQEDKEPLLDALATYRDSLRLLAA
1auwA           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1dcnB           --SEFGFLTLSPDSLELIRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1dcnA           -AFSTNPDSLEL-----IRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
3c8tA           -TELGEVAEPNPVSCELILAGARIVRNHATSMLDAMIHDFERATGPWHLEWSAVPEGFAVASGILYQAEF
1aosA           TGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATG
1c3cA           -RKSAMPHKKNPITCERLTGLSRMMRAYV---DPSLENIALWHERDISHSSVVFPDATQTLYYMIVTATN
1dcnD           -AFSTNPDSLEL-----IRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1c3uA           --RSAMPHKKNPITCERLTGLSRMMRAYV---DPSLENIALWHERDISHSRYVFPDATQTLYYMIVTATN
3e04D           ENEPGMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASSFTEN
3e04B           PGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMIKNVLHSARLLGDASVSFTEN
3e04A           LPENEPGGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLDASVSFTEN
1dofA           -IGEVVEGGANPTASERIVSLARYVRALTHVAFENVALWHERDLTNSANERVWIPEALLALDEILTSALR
3bhgA           QKTSSTPHKVNPIDFENAEGNLGLSNALF---IHFANKLTQSRQRDLSDSTVNLGVAFSYSLIAYHSVAK
1dcnC           -TLSDAPDSLEL-----IRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
3e04C           PGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLDASVSFTEN
2d05A           FYNVYIRYSVEQARQRGFTSAVTIGSFVDTALNQGATGGSDTLQGLLARSGSSSNE-KTFMKNFHAKRTL
1eboA           ----------------------------------------------------------------------
1eboF           ----------------------------------------------------------------------
1eboC           ----------------------------------------------------------------------
3bboD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLKNLKPNKQQMLDLANSGYITATDLADYLVKNHSMPFRKAYQTTASIVNYAXXXXXXXXXXXXXXXXXI
2e9fD           LLPGLKWRRERMWRAAEGGYTLATELADYLAE-KGLPFREAHHVVGRLVRRLVEEGRALKDLTLEELQAH
2e9fC           LLPGLKWRRERMWRAAEGGYTLATELADYLAE-KGLPFREAHHVVGRLVRRLVEEGRALKDLTLEELQAH
2e9fA           LLPGLKWRRERMWRAAEGGYTLATELADYLAE-KGLPFREAHHVVGRLVRRLVEEGRALKDLTLEELQAH
2e9fB           LLPGLKWRRERMWRAAEGGYTLATELADYLAE-KGLPFREAHHVVGRLVRRLVEEGRALKDLTLEELQAH
1auwA           VISTLQISKENMEKALT-PEMLATDLALYLVRKG-VPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1dcnB           VISTLQISKENMEKALT-PEMLATDLALYLVR-KGVPFRQAHTASGKAVHLAETKGITINNLSLEDLKSI
1dcnA           VISTLQISKENMEKALT-PEMLATDLALYLVRKG-VPFRQAHTASGKAVHLAETKGITINNLSLEDLKSI
3c8tA           MLGGLQVFPDRMRENLDHSRGLIVAEAVMMALAPHTGRKEAHDIVYLGCRRAVEDKTGLFEVLRTMPEVA
1aosA           VISTLQIHQENMGQALS-PDMLATDLAYYLVR-KGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTI
1c3cA           VVRNMKVNEERMKKNIDLGLVFSQRVLLKLIE-KGLTRKEAYDIVQRNALKT------------------
1dcnD           VISTLQISKENMEKALT-PEMLATDLALYLVRKG-VPFRQAHTASGKAVHLAETKGITINNLSLEDLKSI
1c3uA           VVRNMKVNEERMKKNIDLGLVFSQRVLLKLIE-KGLTRKEAYDIVQRNALKT------------------
3e04D           CVVGIQANTERINKLMNESLMLVTALNPHI----------GYDKAAKIAKTAHKNGSTLKETAIELGYLT
3e04B           CVVGIQANTERINKLMNESLMLVTALNPHIGA---KIAKTAHKNGSTLKETA------------------
3e04A           CVVGIQANTERINKLMNESLMLVTALNPHI----------GYDKAAKIAKTA------------------
1dofA           VLKNVYIDEERITENLQKPYILTEFHMNRMIK-EGASRAEAYKKAKEVKALT------------------
3bhgA           GNDKLQINKSALQKDLSENWEVLAEAIQTV---RRYNEPNAYEQLKELTRGQIDAENLKKFIKTLSIPEE
1dcnC           VISTLQISKENMEKALT-PEMLATDLALYLVRKG-VPFRQAHTASGKAVHLAETKGITINNLSLEDLKSI
3e04C           CVVGIQANTERINKLMNESMKPKDMLG-------------------------------------------
2d05A           VVDTNPYNKPPNGKNRVKQWDTLVDMG--------KMNLKNV----------------------------
1eboA           ----------------------------------------------------------------------
1eboF           ----------------------------------------------------------------------
1eboC           ----------------------------------------------------------------------
3bboD           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EPRLTIEVLKIFNVKNSVNSKKSYGGTSFDNIKKMIMKYKKx
2e9fD           HPLFAEDALPLLRLETAIHRRRSYGGTAPEAVRERLEEAKK-
2e9fC           HPLFAEDALPLLRLETAIHRRRSYGGTAPEAVRERLEEAKK-
2e9fA           HPLFAEDALPLLRLETAIHRRRSYGGTAPEAVRERLEEAKK-
2e9fB           HPLFAEDALPLLRLETAIHRRRSYGGTAPEAVRERLEEAKK-
1auwA           SPQFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRE-
1dcnB           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1dcnA           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
3c8tA           KPLGEEALRDLTDPRNYL-------GSAGAMVDNVL------
1aosA           SPLFSGDVICVWDYRHSVEQYGALGGTARSSVDWQIRQVRA-
1c3cA           ------------------------------------------
1dcnD           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1c3uA           ------------------------------------------
3e04D           AE----QFDEWVKPKDMLGPK---------------------
3e04B           ------------------------------------------
3e04A           ------------------------------------------
1dofA           ------------------------------------------
3bhgA           A-----KAELKLTPET-------YTGLATQLVKA--------
1dcnC           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
3e04C           ------------------------------------------
2d05A           ------------------------------------------
1eboA           ------------------------------------------
1eboF           ------------------------------------------
1eboC           ------------------------------------------
3bboD           ------------------------------------------