[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21392.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e7rA.bssp"
#ERROR : Can't open dsspfile "1bsvA.bssp"
#ERROR : Can't open dsspfile "2b69A.bssp"
#ERROR : Can't open dsspfile "1e7qA.bssp"
#ERROR : Can't open dsspfile "1bwsA.bssp"
#ERROR : Can't open dsspfile "1db3A.bssp"
#ERROR : Can't open dsspfile "1e7sA.bssp"
#ERROR : Can't open dsspfile "1a2zA.bssp"
#ERROR : Can't open dsspfile "1e6uA.bssp"
#ERROR : Can't open dsspfile "3eheA.bssp"
#ERROR : Can't open dsspfile "1arzB.bssp"
#ERROR : Can't open dsspfile "1aorA.bssp"
#ERROR : Can't open dsspfile "2c29D.bssp"
#ERROR : Can't open dsspfile "2bllA.bssp"
#ERROR : Can't open dsspfile "3c4tA.bssp"
#ERROR : Can't open dsspfile "1dihA.bssp"
#ERROR : Can't open dsspfile "2c54B.bssp"
#ERROR : Can't open dsspfile "3bojA.bssp"
#ERROR : Can't open dsspfile "3d5tA.bssp"
#ERROR : Can't open dsspfile "3dbhC.bssp"
#ERROR : Can't open dsspfile "3c1oA.bssp"
#ERROR : Can't open dsspfile "2a35B.bssp"
#ERROR : Can't open dsspfile "2c5eB.bssp"
#ERROR : Can't open dsspfile "3d5tC.bssp"
#ERROR : Can't open dsspfile "3bohA.bssp"
#ERROR : Can't open dsspfile "2c29F.bssp"
#ERROR : Can't open dsspfile "3dxfA.bssp"
#ERROR : Can't open dsspfile "2c20A.bssp"
#ERROR : Can't open dsspfile "2a35A.bssp"
#ERROR : Can't open dsspfile "3e48A.bssp"
#ERROR : Can't open dsspfile "1c3xA.bssp"
#ERROR : Can't open dsspfile "3e48B.bssp"
#ERROR : Can't open dsspfile "3dbrG.bssp"
#ERROR : Can't open dsspfile "1c3vA.bssp"
#ERROR : Can't open dsspfile "3dhnA.bssp"
#ERROR : Can't open dsspfile "3e5mA.bssp"
#ERROR : Can't open dsspfile "2bkaA.bssp"

## Summary of PDB Search
:312
    1e-28  39%  1e7rA  [c.2.1] GDP-FUCOSE SYNTHETASE
    6e-23  43%  1bsvA  [c.2.1] PROTEIN (GDP-FUCOSE SYNTHETASE)
    9e-23  19%  2b69A  [x.x.x] UDP-GLUCURONATE DECARBOXYLASE 1
    2e-19  39%  1e7qA  [c.2.1] GDP-FUCOSE SYNTHETASE
    1e-17  43%  1bwsA  [c.2.1] PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE
    4e-17  17%  1db3A  [c.2.1] GDP-MANNOSE 4,6-DEHYDRATASE
    3e-16  40%  1e7sA  [c.2.1] GDP-FUCOSE SYNTHETASE
    1e-15   7%  1a2zA  [c.56.4] PYRROLIDONE CARBOXYL PEPTIDASE
    1e-15  39%  1e6uA  [c.2.1] GDP-FUCOSE SYNTHETASE
    9e-15  16%  3eheA  [x.x.x] UDP-GLUCOSE 4-EPIMERASE (GALE-1)
    5e-14   8%  1arzB  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    6e-14   9%  1aorA  [d.152.1 - a.110.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE
    3e-13  13%  2c29D  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    3e-12  15%  2bllA  [x.x.x] PROTEIN YFBG
    5e-12   8%  3c4tA  [x.x.x] ENDORIBONUCLEASE DICER
    8e-12  10%  1dihA  [x.x.x] DIHYDRODIPICOLINATE REDUCTASE
    1e-11  22%  2c54B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    2e-11   9%  3bojA  [x.x.x] CADMIUM-SPECIFIC CARBONIC ANHYDRASE
    2e-11  12%  3d5tA  [x.x.x] MALATE DEHYDROGENASE
    2e-10   8%  3dbhC  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    4e-10  12%  3c1oA  [x.x.x] EUGENOL SYNTHASE
    5e-10  12%  2a35B  [x.x.x] HYPOTHETICAL PROTEIN PA4017
    6e-10  22%  2c5eB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    3e-09  11%  3d5tC  [x.x.x] MALATE DEHYDROGENASE
    4e-09   9%  3bohA  [x.x.x] CADMIUM-SPECIFIC CARBONIC ANHYDRASE
    8e-09  11%  2c29F  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    2e-08   8%  3dxfA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    3e-08  17%  2c20A  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    8e-08  12%  2a35A  [x.x.x] HYPOTHETICAL PROTEIN PA4017
    2e-07  12%  3e48A  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    8e-07   9%  1c3xA  [c.56.2] PENTOSYLTRANSFERASE
    1e-06  10%  3e48B  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    2e-06   5%  3dbrG  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    2e-06   8%  1c3vA  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    3e-04  11%  3dhnA  [x.x.x] NAD-DEPENDENT EPIMERASE/DEHYDRATASE
    4e-04   9%  3e5mA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    8e-04   7%  2bkaA  [x.x.x] TAT-INTERACTING PROTEIN TIP30
:312

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxNRNSRIFITGHKGLVGSAIYRKLKAKGYTNLLIADRKKLDLTNQXXXXXXXXXXXXXXXXXAAAKVGG
1e7rA           ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
1bsvA           ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
2b69A           ------RILITGGAGFVGSHLTDKLDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQ
1e7qA           ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
1bwsA           ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
1db3A           ----SKVALITGVTGQDGSYLAEFLLEKGYEVHGIKFHLHYGDLSDTSNLTRILREVQPDEVYNLGAMSH
1e7sA           ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
1a2zA           ------KVLITGFEPFGGDSKNPTEQIAKYFDRKQIGNAMVYGRVLPVSVKRATIELKRYLEEIKPEIVI
1e6uA           ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
3eheA           -------IVVTGGAGFIGSHVVDKLSESNEIVVIDNLSSGNEEFVNEAARLVKADLAADDIKDWHIAANP
1arzB           ----NIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSS-----
1aorA           ----------------------------------------------------------------------
2c29D           ------TVCVTGASGFIGSWLVMRLLERGYTVRATKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTG
2bllA           ------RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWLVAIA
3c4tA           ----DAEKTLNHLI----SGFETFEKKINYRAYLLQAFTHASYHYNTITDYQRLEFLGDAILDYLITKHL
1dihA           --DANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSFTRPEG
2c54B           ----------------------------------------------------------------------
3bojA           ----------------------------------------------------------------------
3d5tA           ------RVAVTGAAGQIAYSLLFRIANGDLLGKDQPVIQLLDLPQAQAAVKGVVMELDDCAFPLLAGVVG
3dbhC           ---ESAHVCLINATAT-GTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEVSG
3c1oA           ------KIIIYGGTGYIGKFMVRASLSFSHP-TFIYARPLTPDSTPSSVQLREEFRSMGVTIIEGEMEEH
2a35B           ------RVLLAGATGLTGEHLLDRILSEPTLAKVIAPARKALAEHPRLDNPVGPLAELLPQLDGSICLGT
2c5eB           ----------------------------------------------------------------------
3d5tC           ------RVAVTGAAGQIAYSLLFRIANGDLLGKDQPVIQLLDLPQAQAAVKGVVMELDDCAFPLLAGVAR
3bohA           ----------------------------------------------------------------------
2c29F           ----SETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEAT
3dxfA           ------LVVVFGGTGAQGGSVARTLLEDGTFKVRVVTANPRKKAAKELRL-------------QGAEVVQ
2c20A           -----NSILICGGAGYIGSHAVKKLVDEGLSVVVVDNLQTGHEDAITEGAKFYNGDLRDKAFLRDVFTQE
2a35A           ------RVLLAGATGLTGEHLLDRILSEPTLAKVIAPARKALAEHPRLDNPVGPLAELLPQLDGSIDTAF
3e48A           ---------LTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPDDWRGKVSVRQLDYFNQESVEAFKGD
1c3xA           ----------------------------------------------------------------------
3e48B           ---------LTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPDDWRGKVSVRQLDYFNQESVEAFKGD
3dbrG           ----------------------------------------------------------------------
1c3vA           ------RVGVLGAKGKVGTTMVRAVAAADDLTLSAELDTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTT
3dhnA           ---KVKKIVLIGASGFVGSALLNEALNRGFEVTAVVRHPE---KIKIENEHLKVKKADVSSLDEVCEVCK
3e5mA           ------LVVVFGGTGAQGGSVARTLLEDGTFKVRVVTRNPRK-------------------KAAKELRLQ
2bkaA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IYYNLKYKADFITENLQIQTNLIHGAYKCGIKDLIFLGSSCVYPKNCKQPIKETYLLSGKLEETNDAYAI
1e7rA           IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPEAI
1bsvA           IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAI
2b69A           IYHLASPASPIKTLKTNTIGTLNLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDE
1e7qA           IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGASCIYPKLAKQPMAESELLQGTLEPTNEPYAI
1bwsA           IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAI
1db3A           VAVSFESPEYTADVDAMGTLRLLEAIRFLGLERFYQASTSELYGLVQEIPQKETTPF-----YPRSPYAV
1e7sA           IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAI
1a2zA           NLGRIAVNIIDARIPDNDGYQPIDEKIEEDAPLAYMATLPVRAITKTLRDNGIPA---------------
1e6uA           IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAI
3eheA           DVRGAENPDEIYRNNVLATYRLLEAMRKAGVSRIVFTSTSTVYGEAKVIPTPEDYP-----THPISLYGA
1arzB           LDAVKDDFDVFIDFTRPEGTLNHLAFCRQGKGMVIGTTGFDEAGKQARDAAADIAIVFAA------NFSV
1aorA           -SIIEANHMCDELGLDTISTGGTLATAMELYEKGHIKDEELGDAPPFRWGNTEVLHYY--IEKIAKREGF
2c29D           VFHVATPMDFVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAVNIQEHQLPVYDESCWSDMEFCRAKMYFV
2bllA           TPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHLIVGPVNKPRWIYSV
3c4tA           YEDPRQHSPGDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVI--DDFVKFQLEKNE--EDIEVPKA
1dihA           TLNHLAFCRQHGKGMVIGTTGFDEAGKQANVMLKLLEKAAKVMGDYTDIEIIEAHHRHKV----DAPSGT
2c54B           --------SVIMYNNTMISFNMIEAARINGIKRFFYASSACIYFKQLETTNVSLKESDAWPAEPQDAYGL
3bojA           ----------------------------------------------------------------------
3d5tA           ARPRSMERKDLLSANAEIFTVQGAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDL-----PKKNFTAM
3dbhC           SFVEESPENLLDNDPSFFCRFRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALDKPFPE
3c1oA           EKMVSVLKQVDIVISALPFPMISSQIHIINIKRFLPSDFGCEEDRIKPLPPFES-----VLEKKRIIRRA
2a35B           TIKEAGSEEAFRAVDFDLPLAVGKRALEMGARHYLVVSALGADAKSS------------------IFYNR
2c5eB           ----------IMYNNTMISFNMIEAARINGIKRFFYASSACIYFKQLETTNVSLKESDAWPAEPQDAYGL
3d5tC           PRSKGMERKDLLSANAEIFTVQGAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDL-----PKKNFTAM
3bohA           ----------------------------------------------------------------------
2c29F           PMDFESKDPEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHPVYDESCWSDMEFCRAKKMTA
3dxfA           GDQDDQVIMELALNGAYATFIVTNYWECSQEQEVKQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLAA
2c20A           NIEAVMHFAADSLVGVSMEKPLQYYNNNVGALCLLEVMDEFKVDKFIFSSTAATYGEVDVDLITEETMTE
2a35A           CCLGTTIKEAFRAVDFDLPLAVGKRALEMGARHYLVVSALGADAKSSI------------------FYNR
3e48A           TVVFIPSIIHPSFKRIPEVENLVYAAKQSGVAHIIFIGYYADQ---HNNPFHSPYFGYASRLLSTSGIDY
1c3xA           -------------------------------------------------PPLDDPATD--------PFLV
3e48B           TVVFIPSIIHPSFKRIPEVENLVYAAKQSGVAHIIFIGYYADQHNNPFHSP-------------------
3dbrG           ----------------------LADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLD
1c3vA           GFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELH----HPHKADAPSGT
3dhnA           GADAVISAFNPIYDETIKVYLTIIDGVKKAGVNRFLVGGAGSLFIAPGLRLDSGE-------VPENILPG
3e5mA           GAEVVQGDQDDQVIMELALNGAYATFIVTNAWESCSQEQEVKQGKLLADLARRLGLHYV------VYSGL
2bkaA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AKIAGIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNSHFIPAXXXXXXXXXXXXXNTVILWGNGKAK
1e7rA           AKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPM
1bsvA           AKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPM
2b69A           GKRVAETCY--AYKQEGVEVRVARIFNTFGPRHNDGRVVSNFIL---------QALQGEPLTVYGSGSQT
1e7qA           AKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPM
1bwsA           AKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPM
1db3A           AKLYAYWITVNYRESYGMYACNGILFNHESPRRGETFVTRKITRA-----IANIAQGLESCLYLGNMDSL
1e7sA           ARIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPM
1a2zA           -------TISYSAGTYLCNYVMFKTLHFSKIEGYPLKAGFIHVPYTPD----------QVVNKFFLLGKN
1e6uA           AKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQKAPDVVVWGSGTPM
3eheA           SKLACEALIESYCHTFDMQAWIYRFANVIGRRSTHGVIYDFIMKLKRNPE---------ELEILGNGEQN
1arzB           GVNVMLKLLEKAAKVMGDYTDIIEAHHRHKVDAPSG-TALAMGEAIAHALDKDLKDCAVYSREGHTGERV
1aorA           GDKLAEGSYRLAESYGHPELSMTVKKPAYDPRGAEGHGLGYATNNRGGCHIKNYMISPESDDKIKMLILF
2c29D           SKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPI----------TGNEAHYSIIRQ
2bllA           SKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIG-SSRAITQLILNLVEGSPIKLIDGGKQK
3c4tA           MGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVP--------------------RSPVREL
1dihA           ALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAG------DIVGEHTAMFADIGERLEIT
2c54B           ERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAA----FCRKAQTSTDRFEMWGDGLQT
3bojA           ---------------------------------------------------------------GWQAEIV
3d5tA           LRLDHNRALSQLAAKSGKPVASIEKLAVWGNHS--PTMYPDFRFA---------TAEGESLLKLINDDVW
3dbhC           LREHFQSYDDMEDHSHTWIVIIAKYLAQWYSETNGRIPKTYKEKEDFR-----------DLIRQGILKPE
3c1oA           IEAAALPYT------------YVSANCFGA---YFVNYLLHPSPHPNRND---------DIVIYGTGETK
2a35B           VKGELEQALQEQ---GWPQLTIARPSLLFGPREEFRLA--EILAAPIPGKYHGIEACDLARALWREEGKG
2c5eB           EKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREAAPAA----FCRKAQTSTDRFEMWGDGLQT
3d5tC           LRLDHNRALSQLAAKSGKPVASIEKLAVWGNHS--PTMYPDFRFA---------TAEGESLLKLINDDVW
3bohA           ---------------------------------------------------------------GWQAEIV
2c29F           WMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPP-----SLITALSPITGNEAHYSIIRQ
3dxfA           AHFDGKGEVEEYFRDIGVPMTSVRLPCYFENLLSHFLPQKAPDGKS-------------YLLSLPTGDVP
2c20A           TKLAIEKMLHWYSQASNLRYKIFRYFNVAGATPNGIIGEDHRPELQVALGQREKIMMFGDDYNTPDGTCI
2a35A           VKGELEQALQEQ---GWPQLTIARPSLLFGPREEFR--LAEILAAPIAGKYHGIEACDLARALWREEGKG
3e48A           TYVRAYDPLKPYLPELNHKLIYPAGDGRINYITRNDIARGVI-------------AIIKNPDTWGKRYLL
1c3xA           ARAAADHIAQAGVEGHDMALVLGSGWGGAAELLGEVVAIPGFSSVTRSIRVERADGSVRHALVLGSRTHL
3e48B           ----YFGYASRLLSTSGIDYTYVRAYDPLKPYLPELNHKLIYPAGDGRINYITRNDIARGVIIIKNPDTW
3dbrG           KPFPEL--REHFQSYTPWIVIIAKYLAQWYSETN---GRIPKTYKEKEDFRDLIRQGILEENFEEAIKNV
1c3vA           AARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETL-TIRHDSL
3dhnA           VKALGEFYLNFLK-EKEIDWVFFSPAADRPGVRTGRYRLGKD---------------------DIVDIVG
3e5mA           ENIKKLTAGRLAAAHFDGKGEVEEYFRDIGVPMTSVRLPCYFENLLSHFLPQKAPDGKSYLLSLPTGDVP
2bkaA           --------------------------------------------------------------SLPDSWAS


                         .         .         .         +         .         .         .:280
query           REVIHVDDIAEACIFFMKKKTEHFLINIGTGKDYSIKYYLEFIAKVILGNXXXXXXXXXXXPNGSPRKVM
1e7rA           REFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKLL
1bsvA           REFLHVDDMAAASIHVMELQPMLSHINVGTGVDCTIRELAQTIAKVV--GYKGRVVFDASKPDGTPRKLL
2b69A           RAFQYVSDLVNGLVALNSNVSSPV--NLGNPEEHTILEFAQLIKNLV--GSGSEIQFLSEAQDDPQKRKP
1e7qA           REFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKLL
1bwsA           REFLHVDDMAAASIHVMELQPMLSHINVGTGVDCTIRDLAQTIAKVV--GYKGRVVFDASKPDGTPRKLL
1db3A           RDWGHAKDYVKMQW-MMLQQEQPEDFVIATGVQYSVRQFVEMAAAQL-----------------------
1e7sA           REFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRKVVGYKGRVVFDASKPDGTPRKLL
1a2zA           TPSMCLEAEIKAIELAVKVSLDY-----------------------------------------------
1e6uA           REFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKLL
3eheA           KSYIYISDCVDAMLFGLRGDERVNIFNIGSEDQIKVKRIAEIVCEEL-----------GLSPRFRFTMLL
1arzB           PGTIGFATVRAGDIVGEHTAMFLEITHKASSRMTFANGAVRSALWLS-----------------------
1aorA           QDLTALIDSAGLCLFTTFGLGARDLLNAALGWDFTTEDYLKIGERIWAERLFNLKAGLDPARDDTLPKRF
2c29D           GQFVHLDDLCNAHIYLFENPKAEG-RYICSSHDCIILDLAKMLRE--KYPEYNIPTEFKGVDENLKSVCF
2bllA           RCFTDIRDGIEALYRIINRCDGEIINIGNPENEASIEELGEMLLASEKHPLRHHFPPFAGFRVVVEHRKP
3c4tA           LEMEPETAKFSPAERTYDGKVRVTVEVVGKGK--------------------------------------
1dihA           HKASSRMTFANGAVRSALWGKESGLFDMRDVLDLN-----------------------------------
2c54B           RSFTFIDECVEGVLRLTKSDF-REPVNIGSDEMVSMNEMAEMVLSFEEKK---LPIHHIPGPEGVRGRNS
3bojA           TEFSLLNEMVDVDPQGILKKMPGGIYAIAHNRGVTTLEGLKQITKEVKGHVPSVHGDHSSDMLGCGFFKL
3d5tA           NRDTFIPTVGKRGAAIIEAR--------------------------------------------------
3dbhC           DEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFWIL-----------------------
3c1oA           FVLNYEEDIAKYTIKVACDPRCRIVIYRPPKNIISQNELISLWEAKS-----GLSFKKVHMPDEQLVR--
2a35B           VRFVESDELRK-----------------------------------------------------------
2c5eB           RSFTFIDECVEGVLRLTKSD-FREPVNIGSDEMVSMNEMAEMVLSFE--EKKLPIHHIPGPEGVRGRNSD
3d5tC           NRDTFIPTVGKRGAAIIEAR--------------------------------------------------
3bohA           TEFSLLNEMVDVDPQGILKKMPGGIYAIAHNRGVTTLEGLKQITKEVKGHVPSVHGDHSSDMLGCGFFKL
2c29F           GQFVHLDDLCNAHIYLFENPKAEG-RYICSSHDCIILDLAKMLREKY--PEYNIPTEFKGVDENLKSVCF
3dxfA           MDGMSVSDLGPVVLSLKMPEKYVGQNIGLSTCRHTAEEYAALLTKHT-----------------------
2c20A           RDYIHVEDLVAAHFLGLKDLQNGGFYNLGNGNGFSVKEIVDAVREVT--NHEIPAEVAPRRAGDPARLVA
2a35A           VRFVESDELRK-----------------------------------------------------------
3e48A           SGYSYDKELAAILSE-----------ASGTEIKYEPVSLETFAEYDEPKG--FGALLASYHAGARGLLDQ
1c3xA           YEGKGVRAVVHGVRTAAATGAETLILTNGCGGLNQEWGAGTPVLLSDH----------------------
3e48B           GKRYLLSGYSYDKELAA-------ILSEASGTEIKYEPVSLETFAEYDEPKGFGALLASYHAGARGLLDQ
3dbrG           NTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEF----------------------------
1c3vA           DRTSFVPGVLLAVRRIAERPGLTV--GLEPLLD-------------------------------------
3dhnA           NSHISVEDYAAAIDELEHPKHHQERFTIGYLEHH------------------------------------
3e5mA           MDGMSVSDLGPVVLSLLMPEKYVGQNIGLSTCRHTAEEYAALLTKHT----------------RKVVHDA
2bkaA           GHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDL----------------------------------


                         .         *         .         .         .         .         +:350
query           DISLAKKYGWKSKMSLITSIRNTYKSFVRENF
1e7rA           DVTRLHQLGWYHEISLEAGLASTYQWF-LEN-
1bsvA           DVTRLHQLGWYHEISLEAGLASTYQWF-LEN-
2b69A           DIKKAKLLGWEPVVPLEEGLNKAIHYF-RKEL
1e7qA           DVTRLHQLGWYHEISLEAGLASTYQWF-LEN-
1bwsA           DVTRLHQLGWYHEISLEAGLASTYQWF-LEN-
1db3A           --------------------------------
1e7sA           DVTRLHQLGWYHEISLEAGLASTYQWF-LEN-
1a2zA           --------------------------------
1e6uA           DVTRLHQLGWYHEISLEAGLASTYQWF-LEN-
3eheA           SIEKLKRLGWKPRYNSEEAVRMAVRDL-VEDL
1arzB           --------------------------------
1aorA           LEEPMPEGNKGHTVRLKEMLPRYYKLR-----
2c29D           SSKKLTDLGFEFKYSLEDMFTGAVDTC-----
2bllA           SIRNAHRCDWEPKIDMQETIDETLDFF-LRT-
3c4tA           --------------------------------
1dihA           --------------------------------
2c54B           DNNLIKEKGWAPNMRLKEGLRITYFWI-KEQ-
3bojA           WVTGRFDDGYPRPQFDADQGAKAVENAGGV--
3d5tA           --------------------------------
3dbhC           --------------------------------
3c1oA           ---LSQELPQPQNIPVSILHSIFVKGD-LMSY
2a35B           --------------------------------
2c5eB           NNLIKEKLGWAPNMRLKEGLRITYFWI-KEQ-
3d5tC           --------------------------------
3bohA           WVTGRFDDGYPRPQFDADQGAKAVENAGGV--
2c29F           SSKKLTDLGFEFKYSLEDMFTGAVDTC-RAK-
3dxfA           --------------------------------
2c20A           SSQKAKEKGWDPRYNVKTIIEHAWNWH-QKQ-
2a35A           --------------------------------
3e48A           ESNDFKQLNDQPQ-TLQSFLQ-----------
1c3xA           --------------------------------
3e48B           ESNDFKQVNDQ-----PQTLQSFLQENILEH-
3dbrG           --------------------------------
1c3vA           --------------------------------
3dhnA           --------------------------------
3e5mA           KMTDYEKLGFPGARDLANMFRFY---------
2bkaA           --------------------------------