[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21432.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ay0A.bssp"
#ERROR : Can't open dsspfile "2e6kA.bssp"
#ERROR : Can't open dsspfile "1dtwB.bssp"
#ERROR : Can't open dsspfile "3a17E.bssp"
#ERROR : Can't open dsspfile "2bfcB.bssp"
#ERROR : Can't open dsspfile "3a17A.bssp"
#ERROR : Can't open dsspfile "2bffA.bssp"
#ERROR : Can't open dsspfile "2bfdA.bssp"
#ERROR : Can't open dsspfile "3a15A.bssp"
#ERROR : Can't open dsspfile "3a18D.bssp"
#ERROR : Can't open dsspfile "2bp7B.bssp"
#ERROR : Can't open dsspfile "2bp7A.bssp"
#ERROR : Can't open dsspfile "2beuA.bssp"
#ERROR : Can't open dsspfile "2bfcA.bssp"
#ERROR : Can't open dsspfile "2bfbA.bssp"
#ERROR : Can't open dsspfile "1dtwA.bssp"
#ERROR : Can't open dsspfile "2bfeA.bssp"
#ERROR : Can't open dsspfile "2c3yB.bssp"
#ERROR : Can't open dsspfile "3dv0G.bssp"
#ERROR : Can't open dsspfile "2ec5A.bssp"
#ERROR : Can't open dsspfile "3ea4A.bssp"
#ERROR : Can't open dsspfile "3dv0A.bssp"
#ERROR : Can't open dsspfile "3dvaA.bssp"
#ERROR : Can't open dsspfile "3c38A.bssp"
#ERROR : Can't open dsspfile "3dvaE.bssp"
#ERROR : Can't open dsspfile "3dv0C.bssp"
#ERROR : Can't open dsspfile "1csmA.bssp"
#ERROR : Can't open dsspfile "1cx6A.bssp"
#ERROR : Can't open dsspfile "2csmA.bssp"
#ERROR : Can't open dsspfile "3dv0E.bssp"
#ERROR : Can't open dsspfile "3dn8A.bssp"
#ERROR : Can't open dsspfile "5csmA.bssp"
#ERROR : Can't open dsspfile "2c31A.bssp"
#ERROR : Can't open dsspfile "2ebfX.bssp"
#ERROR : Can't open dsspfile "2ag1A.bssp"
#ERROR : Can't open dsspfile "1bfdA.bssp"
#ERROR : Can't open dsspfile "2ebhX.bssp"
#ERROR : Can't open dsspfile "1cp9B.bssp"
#ERROR : Can't open dsspfile "3e12A.bssp"

## Summary of PDB Search
:637
    6e-89  19%  1ay0A  [c.36.1 - c.36.1 - c.48.1] TRANSKETOLASE
    1e-85  20%  2e6kA  [x.x.x] TRANSKETOLASE
    6e-51  19%  1dtwB  [c.36.1 - c.48.1] BRANCHED-CHAIN ALPHA-KETO ACID
    5e-49   8%  3a17E  [x.x.x] ALDOXIME DEHYDRATASE
    6e-49  18%  2bfcB  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT
    2e-48   8%  3a17A  [x.x.x] ALDOXIME DEHYDRATASE
    4e-47  16%  2bffA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    3e-46  16%  2bfdA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    6e-46   8%  3a15A  [x.x.x] ALDOXIME DEHYDRATASE
    1e-45   8%  3a18D  [x.x.x] ALDOXIME DEHYDRATASE
    3e-45  18%  2bp7B  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT
    9e-44  16%  2bp7A  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    6e-43  15%  2beuA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    9e-41  15%  2bfcA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-39  16%  2bfbA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    3e-39  15%  1dtwA  [c.36.1] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    1e-37  16%  2bfeA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    3e-34  13%  2c3yB  [x.x.x] PYRUVATE-FERREDOXIN OXIDOREDUCTASE
    3e-31  18%  3dv0G  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    3e-30   8%  2ec5A  [x.x.x] DERMONECROTIC TOXIN
    5e-30  14%  3ea4A  [x.x.x] ACETOLACTATE SYNTHASE, CHLOROPLASTIC
    6e-30  22%  3dv0A  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-29  20%  3dvaA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    3e-29   8%  3c38A  [x.x.x] AUTOINDUCER 2 SENSOR KINASE/PHOSPHATASE LUXQ
    5e-29  20%  3dvaE  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    9e-29  17%  3dv0C  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    8e-27   9%  1csmA  [a.130.1] CHORISMATE MUTASE
    2e-25  15%  1cx6A  [d.2.1] LYSOZYME
    2e-25  15%  2csmA  [a.130.1] CHORISMATE MUTASE
    6e-25  20%  3dv0E  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    3e-24  14%  3dn8A  [x.x.x] LYSOZYME
    5e-24  15%  5csmA  [a.130.1] CHORISMATE MUTASE
    1e-20  10%  2c31A  [x.x.x] OXALYL-COA DECARBOXYLASE
    3e-18  10%  2ebfX  [x.x.x] DERMONECROTIC TOXIN
    5e-15  15%  2ag1A  [x.x.x] BENZALDEHYDE LYASE
    2e-08  24%  1bfdA  [x.x.x] BENZOYLFORMATE DECARBOXYLASE
    2e-08   7%  2ebhX  [x.x.x] DERMONECROTIC TOXIN
    2e-04  15%  1cp9B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    4e-04   9%  3e12A  [x.x.x] 2-DEHYDRO-3-DEOXYPHOSPHOOCTONATE ALDOLASE
:637

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQNYKFLKDINFPSDLRKLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTPNDRL
1ay0A           -----------------------DKLAVSTIRILAVDTVSKASGHPGAPLGMAPAAHVLWSQMRINRDRF
2e6kA           ----------------------------NAIRFLAIDAVEKARGHPGPGAPLAYLLFREVRHNWPDRDRF
1dtwB           ----------------------------------------------------------------------
3a17E           ----------------------------------------------------------------------
2bfcB           ----------------------------------------------------------------------
3a17A           ----------------------------------------------------------------------
2bffA           ------EDPHLPKEKVLKLYKS-MTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALD-NTDLV
2bfdA           ------EDPHLPKEKVLKLYK-SMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALD-NTDLV
3a15A           ----------------------------------------------------------------------
3a18D           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
2bp7A           --------DID-PQILRQGMRAMLSRMVVAQRQKKMSFYMQSLGEEAIGSGQALALNRTDMCFPTYRQQS
2beuA           --------------KVLKLYK-SMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALD-NTDLV
2bfcA           ------EDPHLPKEKVLKLYKS-MTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALD-NTDLV
2bfbA           -------------------------------RILYESQRQGRISFYMTNYGEEGTHVGSAAALD-NTDLV
1dtwA           ------EDPHLPKEKVLKLYK-SMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALD-NTDLV
2bfeA           ------EDPHLPKEKVLKLYKSMTL-LNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALD-NTDLV
2c3yB           ----------------------------------------------------------------------
3dv0G           -----EGEVVN-EEAMPELSDEQLKELMRRMVRSISLNRQGRLGFYAPTAGQEASQIASHFALE-KEDFI
2ec5A           ----------------------------------------------------------------------
3ea4A           -------------------------------NKVLENRAEELKLDFGVWRNELNVQKQKFPLSFKTFGEA
3dv0A           ---------VVNEEAMPELSDEQLKELMRRMVYQRSISLNRQGGFYAPTAGQEASQIASHFALE---KED
3dvaA           ------------EEAMPELSDEQLKELMRRMVRSISLNRQGRLGFYAPTAGQEASQIASHFALE-KEDFI
3c38A           QTSSLIQSLFDFRLAALRIHQDSTAKNASLINALVSRDSSRLD-EFFSSVDELELSNAPDLRFISSHDNI
3dvaE           ---------VVNEEAMPELSDEQLKELMVYTRILDQRSISLNRGFYAPTAGQEASQIASHFALE-KED--
3dv0C           -QILNEEGEVVNEEAMPELSDEQLKELMRRMVYDQRSISLNRQGRLGFTAGQEASQIASHFALE-KEDFI
1csmA           QKSFLPSINYPQILAPYAPEVNYNDKIKKVYIEKIIPLISKRDGDDKNNFGSIECLQSIHFGKFVAEAKF
1cx6A           ----------------------------------------------------------------------
2csmA           ---KSFLPSINYPQILAPYAPNYNDKIKKVYIEKIIPLISKRDGDDKNNFGSVATDIECLQSLSRRIHFG
3dv0E           ---------VVNEEAMPELSDEQLKELMVYTRILDQRSISLNRGFYAPTAGQEASQIASHFALE-KED--
3dn8A           ----------------------------------------------------------------------
5csmA           ------LPSINYPQILAPPEVNYNDKIKKVYIEKIIPLISKRDGDDKNNFGSQSLSRRIHFGKFVAEAKF
2c31A           -----------------------------------------------------------KLAGKMTAETP
2ebfX           ----------------------------------------------------------------------
2ag1A           ----------------------------------------------------------------------
1bfdA           ----------------------------------------------------------------------
2ebhX           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
3e12A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNKLN
1ay0A           VLSNGHAVYSMLHLTGYIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATY
2e6kA           VLSAGHGSLLYAVLTGYDLPLEELKSGSKTPGHPERGHTPGVEVTTGPLGQGISTAVGLALAERKLAAEF
1dtwB           ----------------------------------------------------------------------
3a17E           ----------------------------------------------------------------------
2bfcB           ----------------------------------------------------------------------
3a17A           ----------------------------------------------------------------------
2bffA           FGQYREAGPLELFMAQCYGNISDLGKGRQMPVHY-GCKERHFVTISSPLATQIPQAVGAAYAAKRANANR
2bfdA           FGQAREAGPLELFMAQCYGNISDLGKGRQMPVHY-GCKERHFVTISSPLATQIPQAVGAAYAAKRANANR
3a15A           ----------------------------------------------------------------------
3a18D           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
2bp7A           IL-MARDVSLVEMICQLLSNERDPLKGRQLPIMYSV-REAGFFTISGNLATQFVQAVGWAMASAIKGDTK
2beuA           FVLMYRDYPLELFMAQCYGN-ISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANR
2bfcA           FGQFREADYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANR
2bfbA           FGAYREAGYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANR
1dtwA           FGQYREAGYRDYPLELFMAQCISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANR
2bfeA           FGAAREAGYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANR
2c3yB           ----------------------------------------------------------------------
3dv0G           LPGYRD--VPQIIWHGLPLY-QAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRGKKA
2ec5A           --------SPFRIGLEGVWTPEVLKARA--SVIGKPIGESYKRILAKLQRIHNSNILDGLMHELMELIDL
3ea4A           IPPQYAIKVLDELTDGKAIISTGVGQHQMWAAQFYNYK-KPRQWLSSGGLGAMGFGLPAAIGASVANPDA
3dv0A           FILPGYRDVPQIIWHGLPLY-QAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRGKKA
3dvaA           LPG--YRDVPQIIWHGLPLY-QAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRGKKA
3c38A           LWDDGNASFYGIAQQELNKRRVAISGNWHLVQTPSEGKSVHILMRRSSLIEVLNDNFALLENIRSGSNSE
3dvaE           FILPGYRDVPQIIWHGLPL-YQAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRGKKA
3dv0C           LPG--YRDVPQIIWHGLPLY-QAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRGKKA
1csmA           QSD--IPLYTKLIKSKDVEGIMKNITNSAVEEKILERLTKKAEVYGVDPTERRIIPEYLVKIYK-----E
1cx6A           --------------------IFELRIDEGLRLKIYKDTEGYYTIGIGHLLTKSP-SLNAAKSELDKAIGR
2csmA           KFVADIPLYTKLIKSKDVEGIMKNITSAVEEKILERLTKKAEVYG-------------------------
3dv0E           FILPGYRDVPQIIWHGLPLY-QAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRGKKA
3dn8A           --------------------IFELRIDEGLRLKIYKDTEGYYTIGIGHLLTKSP-SLNAAKSELDKAIGR
5csmA           QSD--IPLYTKLIKSKVEGIMKNITNSAVEEKILERLTKKAEVYGVDPTRISPEYLVKIYKE--------
2c31A           SGMMNYSNSLGVVRDFMLANPDISLVNEGMIVDMLKPRKRLDSGTWGVMGIGMGYCVAAAAVTGK-----
2ebfX           ----------------------------------------------------------------------
2ag1A           ----------------------------WLSEVSRVKPGGFLCHGYLGSGVGF--GTALGAQVADLEAGR
1bfdA           ----------------------------------------LNMRNPGSYYFCAAGGLGFALPAQLAEPER
2ebhX           ----------------------------------------------------------------------
1cp9B           --------------------------------------------VWLVGKTKASGAKAILLNGPQ-FGWF
3e12A           ---------------------------------------RQTDLLLAAAKTGRAVNVKKGQFLAPWDTKN


                         +         .         .         .         .         *         .:210
query           NIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRETFKL
1ay0A           NTYVFLGDGCLQEGISSEASSLAGHLKLGNIAIYDDNKITIDGATISFDEDVAKRYEAYGWEVLYEDLAG
2e6kA           NTYVLASDGD-LEGVSGEAASLAGHWGLSKIVFWDDNRISIDGPTDLAFTEVLARYRAYGWQTLRVEDVN
1dtwB           ----------------------------------------------------------------------
3a17E           ----------------------------------------------------------------------
2bfcB           ----------------------------------------------------------------------
3a17A           ----------------------------------------------------------------------
2bffA           VVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYDGIAARGPGYGIMSIRVDGN-
2bfdA           VVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRG--------DGIAARGPG--
3a15A           ----------------------------------------------------------------------
3a18D           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
2bp7A           IASAWIGDGATAESDFHTALTFAHVYRAPVILNVVNNQWAISTFQAIAGGESTT----------------
2beuA           VVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYDGIAARGPGYGIMSIRVDGN-
2bfcA           VVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRG--------------DGIAA
2bfbA           VVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRG-------------------
1dtwA           VVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYDGIAARGPGYGIMSIR-----
2bfeA           VVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYDGIAARGPGYGIMSIR-----
2c3yB           ----------------------------------------------------------------------
3dv0G           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQTKTLAQKAVAAGIPGIQVDGM-
2ec5A           YEESQPSSERLNAFRELRTQLEKALYLPEMEALKKQILQIPNKGSGAARFLLRTAMNEMAGSESTADLIR
3ea4A           IVVDIDGDGS--FIMNVQELATIRVENLPVKVLLLNNQ------HLGMVMQWEDRFYKANRAHTFLGDPA
3dv0A           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQTKTLAQK---------------
3dvaA           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAASTPVEKQTVA-------------------
3c38A           NLVLAVDTTPLVSTLKGNEPYSLDYVVDADSFIVGQTFLEVESVPTYLCVYSIQ----------------
3dvaE           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAASTPVEKQT---------------------
3dv0C           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQTKTLAQKAVAAGIPGIQ-VDGM
1csmA           IVIPI-----------------------------------------------------------------
1cx6A           NTNGVITKDEAEKLFNQDVDAAVRGILRNAKKPVYDSDAVR---RAAINVFQGETGVAGFTNSRQ--QKR
2csmA           ----------------------------------------------------------------------
3dv0E           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQTVA-------------------
3dn8A           NTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAAAINQGETGVAGFTNSLRLQQ----
5csmA           ----------------------------------------------------------------------
2c31A           --PVIAVEGDSAFGFSGMELETICRYNLPVTVIIMNNGGIYKGNEADPQPGVISCTRLTRG---------
2ebfX           ----------------------------------------------------------------------
2ag1A           RTILVTGDG--SVGYSIGEFDTLVRKQLPLIVIINNQSWGATLHFQQLAVGP------------------
1bfdA           QVIAVIGDG--SANYSISALWTAAQYNIPTIFVIMNNG------TYGALRWFAGVLEAENVPGL------
2ebhX           ----------------------------------------------------------------------
1cp9B           NPAYTYGIGLH-----GAGFNIVGNTAYPAILFGHNGHVSWGSTA-------------------------
3e12A           VVEKLKFGGAKEIYLTERGTTFGY-----NNLVVDFRSL------------------PIMKQWAKVIYDA


                         .         .         .         +         .         .         .:280
query           IVSAFSKRFSVKAGKAEDFLRSAVTGGTLFNSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIK
1ay0A           IAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVAGAPLKADDVKQLKSKFGFNPDKSF--VVPQEVY
2e6kA           DLEALRKLAKLDERPTLIAVRSHIGFGSPKQDSAKAHGEPLGPEAVEATRRNLGWPYP-----PFVVPYR
1dtwB           ----------------------------------------------------------------------
3a17E           ------------------------------------------------------------GRADDALQQV
2bfcB           ----------------------------------------------------------------------
3a17A           ----------------------------------------------------------------------
2bffA           ------DVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYREVGYWDKQDH--PISRLRH
2bfdA           ---------------------------------YGIMSIRVDGNDVFAVYNATKEARRVAENQPFLIEAM
3a15A           ----------------------------------------------------------------------
3a18D           -----------------------------------------------------------VGRADDALQQV
2bp7B           ----------------------------------------------------------------------
2bp7A           ----FAGRGVG----------------------CGIASLRVDGNDFVAVYAASRWARARRGLGPSLIEWV
2beuA           ------DVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRNYWDKQDHPIS--RLRHYL
2bfcA           RGPGY-----------------------------GIMSIRVDGNDVFAVYNATKEARAVAENQPFLIEAM
2bfbA           ----------------DGIAARGPGYG--------IMSIRVDGNDVFAVYNATKEARAVAENQPFLIEAM
1dtwA           ----------VDGNDVFAVTKEARAVAENQPFLIEAMTYRIGHHSTSD--------DSSAYRHPISRLRH
2bfeA           -VDGNDVFAVYNATKEARRRAVAENQPFLIE-----AMTYRIGHSTDHPISRLRHYLL--SQGW------
2c3yB           -------------------------------------------------------------SSTMGEEAD
3dv0G           --DPLAVYAAVKAARERAI---NGEGPTLIETLCFRYGPHTDPTNEWAK----------KDPLVRFRKFL
2ec5A           FALQDTVISAPFRGYAGAIPEAIDFPVEDISVFDKIQTNYWELPAYESWNEGSNSALL--PGLLRESQSK
3ea4A           QEDEIFPNM-----------------LLFAAACGIPAARVTKKAD---LREAIQTMLDTP--GPYLLDVI
3dv0A           ---------------AVAA---------------GIPGIQVDGMDPLAVYAAVKAAREINGEGPTLIETL
3dvaA           ----------------KTLAQKAVAAG--------IPGIQVDGMDPLAVYAAVKAAREINGEGPTLIETL
3c38A           ----------------------------------------------------------------------
3dvaE           --------------VAKTLAQ-------KAVAAGIPGI-QVDGMDPLAVYAAVKAAREINGEGPTLIETL
3dv0C           DPLAVYAAVK----AARERAIN--GEGPTLIETLCFRYGPHTENEWAK-----------KDPLVRFRKFL
1csmA           ----------------------------------------------------------------------
1cx6A           WDEAAVNAKSYNQTRAKRVITTRTGTWDAY----------------------------------------
2csmA           ----------------------------------------------------------------------
3dv0E           --KTLAQKAVAA----------------------GIPGIQVDGMDPLAVYAAVKAARAINGEGPTLIETL
3dn8A           ----------------------------------------------------------------------
5csmA           ----------------------------------------------------------------------
2c31A           -----------------RYDM-------MMEAFGGKGY-VANTP--AELKAALEEA--VASGKPCLINAM
2ebfX           ----------------------------------------------------------------------
2ag1A           ------NRVTGTRLENGSYHGVAAAFG----------ADGYHVDSVESFSAALAQALAHN--RPACINVA
1bfdA           -----------------------DVPGIDFRALAKGYGVQLKADNLEQLKGSLQEAL--SAKGPVLIEVS
2ebhX           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
3e12A           THSVQLPGGGGMREFIFPLIRAAV-------AVGCDGV-FMETHP--EPEKALSDASTQL--PLSQLEGI


                         .         *         .         .         .         .         +:350
query           TQKGKGYSYAEKASDHYHGVSKFNVVTGEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTG
1ay0A           DHYQKTILKPGVEANNKWNLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNL
2e6kA           HDREKGRAWQEAWEKALEAYARAYPDLHQELRRLRGLPATRAASGRALNLLAPRLPELLGLTPSNNTKAE
1dtwB           -------------------------------------MNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGV
3a17E           VMGYLGVQFRDEDQRPAALQAMRDIVAGFD-------LPDGPAHHDLTHHIDNQGYENLIVVGYWKDVSS
2bfcB           -----------------------------FEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGV
3a17A           PRTLTRRVPDTYTPPFPMWVGRADDALQQ---------VVMGYLGVQFRDEDQRPAALQAMRDIVAGFDL
2bffA           YLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNLFSDVYQEMPAQLRKQQESLARHLQTYGEHYP
2bfdA           TYRIGSTDHPISRLRHYLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAARH
3a15A           PRTLTRRVPDTYTPPFPMWVGRADDALQQ---------VVMGYLGVQFRDEDQRPAALQAMRDIVAGFDL
3a18D           VMGYLGVQFRDEDQRPAALQAMRDIVAGFD-------LPDGPAHHDLTHHIDNQGYENLIVVGYWKDVSS
2bp7B           --------------------------------------TMIQALRSAMDVMLERDDNVVVYGQDVGYFGG
2bp7A           TYRAGPHSTSDDPSKYRPADDWSHFPLGDPIARLKQHLIKIGHWSEEEHQATTAEFEAAVIAAQKEAEQY
2beuA           LSQGWWDEEQEKAWRKQSRRKVMEAFQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYP
2bfcA           TYRIDHPISRLRHYLLSQGWWDEEQEKAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYP
2bfbA           TYRDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFSDVYQEMPAQLRKQQESLARHLQTYGEHYP
1dtwA           YLLSQGWWDEEQEKAWRKQSRRKAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYP
2bfeA           ------WDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNFSDVYQEMPAQLRKQQESLARHLQTYGEHYP
2c3yB           DWAAQGRKNIFGQTLTISEAGAAGAVHGA-LAAGALTTTFTALMIPNMYKISGELLPGVFHVTARAIAAH
3dv0G           EAKGLWSEEEENNIEQAKEEIKEAIKKADETPKQKVTDLISIMFEELPFNLKEQYEIYK-----------
2ec5A           GMLSKCRIIENSLYIGHSYEEMFYSISPYSNQVGGPYLYPFTFFSMLQEVQGDLGFEQAFATRNFFNTLV
3ea4A           CPHQEHVLPMIPSGGTFNDVITE-----------------------------------VETVFAYPGGAS
3dv0A           CFRYGPHENEWAKKDPLVRFRKFLEAKG------------------------------------------
3dvaA           CFRYGPHTMSGDDPTRYRSKELENEWAK------------------------------------------
3c38A           ----------------------------------------------------------------------
3dvaE           CFRYGPHTMSGDNEWAKKDPLVR-----------------------------------------------
3dv0C           EAKGLWSEEEENNEQAKEEIKEAIKKADETPKQKVT-DLISIMFEELPFNLKEQYEIYK-----------
1csmA           ----------------------------------------------------------------------
1cx6A           ----------------------------------------------------------------------
2csmA           ----------------------------------------------------------------------
3dv0E           CFRYEWAKKDPLVRFRKFLEAK------------------------------------------------
3dn8A           ----------------------------------------------------------------------
5csmA           ----------------------------------------------------------------------
2c31A           IDPDAGV---------------------------------------------------IDTMYGVVGIPI
2ebfX           ----------------------------------------------------------------------
2ag1A           VALDPIP---------------------------------------------------------------
1bfdA           T---------------------------------------------------------------------
2ebhX           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
3e12A           IEAILEIREVAS----------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           MDIFAKDFPKRMFDVGIAEQHAVTFAAGLATEGYKPYVAIYSTFLQRAYDQVVHDVAIQSLPVRFIIDRA
1ay0A           TSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDS
2e6kA           GEDFSRANPLRYLHFGVREHAGAILNGLNLHGGYRAYG---GTFLVFSDYRPAIRLAALGVPTVFVFTHD
1dtwB           FGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAIQFADYIFPAFDQIVNEAALFNCGSLTIRSPW
3a17E           QHRWSTSTPIASWWESEDRLSDGLGFF-------------REIVAPRAEQFETLYA--------FQEDLP
2bfcB           FGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAIQFADYIFPAFDQIVNEAALFNCGSLTIRSPW
3a17A           PDGPAHHDLTHHIDNLIVVGYWKDVSSQHRWSTSTPIASWWESED-RLSDGLGFFREIVAPRAEFQEDLP
2bffA           LDHFDK----------------------------------------------------------------
2bfdA           LQTYGEHYPLDHFD--------------------------------------------------------
3a15A           PHDLTHHIDNQGYENLIVVGYWKDVSSQHRWSTSTPIASWW-ESEDRLSDGLGFFREIVAPRAEFQEDLP
3a18D           QHRWSTSTPIASWWESEDRLSDGLGFF-------------REIVAPRAEQFETLYA--------FQEDLP
2bp7B           VFLQTKYGKSRVFDAPISESGIVGTAVGMGAYGLRPVVEIQADYFYPASDQIVSEMARLRFIAPLTLRMP
2bp7A           GTLANGHIPSAMFEDVYKEMPD------------------------------------------------
2beuA           LDHFDK----------------------------------------------------------------
2bfcA           LDHFDK----------------------------------------------------------------
2bfbA           LDHFDK----------------------------------------------------------------
1dtwA           LDHFDK----------------------------------------------------------------
2bfeA           LDHFDK----------------------------------------------------------------
2c3yB           ALSIFGDHQDIYAQTGFAMHDMALVAHLAAIESNVPFMHFFDGFR--------TSHEIQKIEVLDYADMA
3dv0G           ----------------------------------------------------------------------
2ec5A           SDRLSLMENTMLLTESFDYTPWDAIYGDINYDEQFAAMSINERIEKCMNTYRGVAFQNSSKSIDFFLNNL
3ea4A           MEIHQARSSSIRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGATNLVSG-LADALLDSVPLVAITGQV
3dv0A           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3c38A           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
1csmA           ----------------------------------------------------------------------
1cx6A           ----------------------------------------------------------------------
2csmA           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dn8A           ----------------------------------------------------------------------
5csmA           ----------------------------------------------------------------------
2c31A           TNLAMWQDDGQRFYSFRHEQHAGYAASIAGYIEGKPGVCLT-VSAPGFLNGVLAHATTNCFPMILLSGSS
2ebfX           ----------------------------------------------------------------------
2ag1A           ----------------------------------------------------------------------
1bfdA           ----------------------------------------------------------------------
2ebhX           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
3e12A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GLVGADGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRYPRGNGIGVELPSIDE
1ay0A           IGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIES
2e6kA           SILGEDGPTHQPVEHLSLR--APNLFVIRPADAYETFYAWLVALRRKEGPTALVLTRQAVPLLSPEKARG
1dtwB           G-CVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKN-PCIFFEPKILYRAAAEEVPIE
3a17E           GVGAVMDGISGEINEHGYWGSMRERFPISQTDWMQASGELRVIA---GDPAVGGRVVVRGHD------NI
2bfcB           G-CVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIE-DKNPCIFFEPKILYRAAAEEVPIE
3a17A           GVGAVMDGISGEINEHGYWGSMRERFPISQTDWMQASGELRVIA---GDPAVGGRVVV------RGHDNI
2bffA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
3a15A           GVGAVMDGISGEINEHGYWGSMRERFPISQTDWMQASGELRVIA---GDPAVGGRVVV------RGHDNI
3a18D           GVGAVMDGISGEINEHGYWGSMRERFPISQTDWMQASGELRV---IAGDPAVGGRVVVRGHD------NI
2bp7B           CGGGIYGGQTHSQSPEAMFTQVCGLRTVMPSNPYDAKGLLIASIECDDPVIFLEPKRLYNGPFDGHHDRP
2bp7A           ----------------------------------------------------------------------
2beuA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
2c3yB           SLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPGIVAEYMQKVAS-------LTG
3dv0G           ----------------------------------------------------------------------
2ec5A           TTFIDNGLTEIAISDLPYDIVQQEISQFLQGSNEWKTLDAMLFNLDKGDINGAFRKLLQSAKDNNIKFRA
3ea4A           PRRMIGTDAF-QETPIVEVTTKHNYLVMDVEDIPRIIE--------------------------------
3dv0A           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3c38A           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
1csmA           ----------------------------------------------------------------------
1cx6A           ----------------------------------------------------------------------
2csmA           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dn8A           ----------------------------------------------------------------------
5csmA           ----------------------------------------------------------------------
2c31A           EREIVDLQQGDEEMDQMNVACKASFRINSIKDIPIGIA--------------------------------
2ebfX           -----------------------------------------------AFRKLLQSAKDNNIKFRAPFNNP
2ag1A           ----------------------------------------------------------------------
1bfdA           ----------------------------------------------------------------------
2ebhX           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
3e12A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           NIEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIVDARFAKPLDQELILKCAREHEAMIT
1ay0A           ASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSDNVPIMS
2e6kA           LLRGGYVLEDVEEPQGVLVATGSEVHLALRAQALLREKGVRVRVVSLPSFELFAEAYRKEVLPPGLPVVA
1dtwB           PIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLI
3a17E           ALIRSGQDWADAEADERSLYLDEILPTLQSGMDFLRDNGPAVGCYSNRFVRNIDIDGNFLDLSYNIGHWA
2bfcB           PYPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLI
3a17A           ALIRSGQDWADAEADERSLYLDEILPTLQSGMDFLRDNGPAVGCYSNRFVRNIDIDGNFLDLSYNIGHWA
2bffA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
3a15A           ALIRSGQDWADAEADERSLYLDEILPTLQSGMDFLRDNGPAVGCYSNRFVRNIDIDGNFLDLSYNIGHWA
3a18D           ALIRSGQDWADAEADERSLYLDEILPTLQSGMDFLRDNGPAVGCYSNRFVRNIDIDGNFLDLSYNIGHWA
2bp7B           VVPLDKAAITRPGNDVSVLTYGTTVYVAQVAAEESG---VDAEVIDLRSLWPLDLDTIVESVKKTGRCVV
2bp7A           ----------------------------------------------------------------------
2beuA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
2c3yB           RSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALASAKVITV
3dv0G           ----------------------------------------------------------------------
2ec5A           IGHSDNSVPPFNNPYKSLDREGQKFVVFADSSLLNSTPGTGRPMPGLVQYLKIPATVVDSDGAWASSRVP
3ea4A           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3c38A           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
1csmA           ----------------------------------------------------------------------
1cx6A           ----------------------------------------------------------------------
2csmA           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dn8A           ----------------------------------------------------------------------
5csmA           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------
2ebfX           YKSLYYKGNIIAEAIEKLDREGQKFVVFADSSLLNSTPGTGRPMPGLVQYLKIPATVVDSLPDVASSRVP
2ag1A           ----------------------------------------------------------------------
1bfdA           ----------------------------------------------------------------------
2ebhX           ----------------KLDREGQKFVVFADSSLLNSTPGTGRPMPGLVQYLKIPATVVDSDGAVASSRVP
1cp9B           ----------------------------------------------------------------------
3e12A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           VEEGSIGGFGSHVENLLSEKGIFDKGLKFRTMILPDIFIEQDSPKKMYDVAGLNASQISKKILDILFTKE
1ay0A           VEVLATTCWGKYAHQSFGI----------------DRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYK
2e6kA           VEAGASLGWERYAHKVVA----------------LDRFGASAPYPEVYERLGFTPERVAEAFLSLV----
1dtwB           SHEALTGGFASEISSTVQEECFLNLEAPISRVCGYDTP----FPHIFEPFYIPDKWKCYDALRKMI----
3a17E           SLDQLEWSESHPTHLRIFTTFFRVAGLSKLRLYHEVSVFDAADQLYEYINTGMLRDAV------------
2bfcB           SHEPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTP----FPHIFEPFYIPDKWKCYDALRKMI----
3a17A           SLDQLEWSESHPTHLRIFTTFFRVAGLSKLRLYHEVSVFDAADQLYEYINCHPGTGMLRDAV--------
2bffA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
3a15A           SLDQLEWSESHPTHLRIFTTFFRVAGLSKLRLYHEVSVFDAADQLYEYPGTGMLRDAVTIAE--------
3a18D           SLDQLEWSESHPTHLRIFTTFFRVAGLSKLRLYHEVSVFDAADQLYEHPGTGMLRDAV------------
2bp7B           VHETRTCGFGAELVSLVQEHCFHHLEAPIERVTGWDTP----YPHAQEWAYFPGPSRVGAALKKVM----
2bp7A           ----------------------------------------------------------------------
2beuA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
2c3yB           LDRTKEPGAPGDPLYLDVCSAFVERGEAMPKILAGRYG--------------------------------
3dv0G           ----------------------------------------------------------------------
2ec5A           IEVTELENWQVL-------------TPPQGKILGLKQFKLTAGFPTEQSRLPLLENSVSEDLREELMQK-
3ea4A           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3c38A           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
1csmA           ----------------------------------------------------------------------
1cx6A           ----------------------------------------------------------------------
2csmA           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dn8A           ----------------------------------------------------------------------
5csmA           ----------------------------------------------------------------------
2c31A           ----------------------------------------------------------------------
2ebfX           IEVTELENWQVLT------------PPQGKILGLKQ-FKLTAGFPTEQSRLPLLENSVSEDLREEL--MQ
2ag1A           ----------------------------------------------------------------------
1bfdA           ----------------------------------------------------------------------
2ebhX           IEVTELENWQVLT------------PPQGKILGL-KQFKLTAGFPTEQSRLPLLENSVSEDLREELM---
1cp9B           ----------------------------------------------------------------------
3e12A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SIKVVKN
1ay0A           GDKLIS-
2e6kA           -------
1dtwB           -------
3a17E           -------
2bfcB           -------
3a17A           -------
2bffA           -------
2bfdA           -------
3a15A           -------
3a18D           -------
2bp7B           -------
2bp7A           -------
2beuA           -------
2bfcA           -------
2bfbA           -------
1dtwA           -------
2bfeA           -------
2c3yB           -------
3dv0G           -------
2ec5A           -------
3ea4A           -------
3dv0A           -------
3dvaA           -------
3c38A           -------
3dvaE           -------
3dv0C           -------
1csmA           -------
1cx6A           -------
2csmA           -------
3dv0E           -------
3dn8A           -------
5csmA           -------
2c31A           -------
2ebfX           KIDAIKN
2ag1A           -------
1bfdA           -------
2ebhX           -------
1cp9B           -------
3e12A           -------