[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21456.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ay9A.bssp"
#ERROR : Can't open dsspfile "3bdnA.bssp"
#ERROR : Can't open dsspfile "1b12B.bssp"

## Summary of PDB Search
:131
    6e-20  34%  1ay9A  [b.87.1] UMUD PROTEIN
    1e-08  18%  3bdnA  [x.x.x] LAMBDA REPRESSOR
    1e-05  13%  1b12B  [b.87.1] SIGNAL PEPTIDASE I
:131

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxDYIEEDVDLNVHLIKNVPATFIIRVQGKSMTDVGIYDGDLLVIDRSLKP
1ay9A           ---------------------DYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITA
3bdnA           --------------------------------------------------GSKPSFPDGMLILVDPEQAV
1b12B           -----------------------------------------EPFQIPSGSMMP-TLLIGDFILVEKFGHP


                         .         .         *         .         .         .         .:140
query           KNFSTVVANVHDELVVKSFVRSKDGQFLTSGSKNIEDKIIIGDESEVFIWGVVTYVIHxxx
1ay9A           SHGDIVIAAVDGEFTVKKLQL-RPTVQLIPMNSAYSP-ITISSEDTLDVFGVVIHVVK---
3bdnA           EPGDFCIALGGDEFTFKKLIRGSGQVFLQPLNPQYPMI-----PESCSVVGKVIASQW---
1b12B           KRGDIVVFKYPEDDYIKRAVGLPGDKVTYDPVSKELTIQPGCCENALPVTYSNVE------