[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21597.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dfuA.bssp"
#ERROR : Can't open dsspfile "2dfuB.bssp"
#ERROR : Can't open dsspfile "2dfuD.bssp"
#ERROR : Can't open dsspfile "2eb5A.bssp"
#ERROR : Can't open dsspfile "2eb5E.bssp"
#ERROR : Can't open dsspfile "2eb6D.bssp"
#ERROR : Can't open dsspfile "2eb4C.bssp"
#ERROR : Can't open dsspfile "2eb4A.bssp"
#ERROR : Can't open dsspfile "2eb4B.bssp"
#ERROR : Can't open dsspfile "2eb4D.bssp"
#ERROR : Can't open dsspfile "2eb6A.bssp"
#ERROR : Can't open dsspfile "2eb5B.bssp"
#ERROR : Can't open dsspfile "3dgsB.bssp"
#ERROR : Can't open dsspfile "3dgsA.bssp"
#ERROR : Can't open dsspfile "2bh0A.bssp"

## Summary of PDB Search
:281
    1e-55  28%  2dfuA  [x.x.x] PROBABLE 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE
    3e-53  29%  2dfuB  [x.x.x] PROBABLE 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE
    2e-52  29%  2dfuD  [x.x.x] PROBABLE 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE
    3e-50  16%  2eb5A  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    6e-49  15%  2eb5E  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    9e-48  16%  2eb6D  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    2e-47  16%  2eb4C  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    1e-46  16%  2eb4A  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    6e-46  16%  2eb4B  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    8e-46  16%  2eb4D  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    3e-44  16%  2eb6A  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    3e-43  16%  2eb5B  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    1e-41   8%  3dgsB  [x.x.x] COAT PROTEIN A
    5e-35   5%  3dgsA  [x.x.x] COAT PROTEIN A
    1e-19  13%  2bh0A  [x.x.x] YOAJ
:281

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRIGSCISKP
2dfuA           ---------------------------------------------------------------------P
2dfuB           ---------------------------------------------------------------------P
2dfuD           ---------------------------------------------------------------------P
2eb5A           -------------------------------------------------------------RLKIAEGRT
2eb5E           -------------------------------------------------------------REWVRLKIA
2eb6D           -------------------------------------------------------------RLKIAEGRT
2eb4C           -------------------------------------------------------------RLKIAEGRT
2eb4A           -------------------------------------------------------------RLKIAEGRT
2eb4B           -------------------------------------------------------------RLKIAEGRT
2eb4D           -------------------------------------------------------------RLKIAEGRT
2eb6A           -------------------------------------------------------------RLKIAEGRT
2eb5B           -------------------------------------------------------------RLKIAEGRT
3dgsB           ------------------------------------------------------------------ATGV
3dgsA           ---------------------------------------------------------------------V
2bh0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVIGKKAKRVLE
2dfuA           TKIVCVGRNYRLPKEPGLFLKGPNALARPGNPRDPWGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVPP
2dfuB           TKIVCVGRNYPKEPGLFLK--GPNALARPGNPRDPWGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVPP
2dfuD           TKIVCVGRNYEPGLFLKGPNALARPGNPR----DPWGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVPP
2eb5A           LKGHKIGLTSKAMQASSQ---ISEPDYGALLDDMFFHDGSDIPTDRFIV-PRIEVELAFVLAKPLRNCTL
2eb5E           EGRTLKGHKIGLTSKAMQASQISEPDYGALLDDMFFHDGSDIPTDR-FIVPRIEVELAFVLAKRGPNCTL
2eb6D           LKGHKIGLTSKAMQASSQ---ISEPDYGALLDDMFFHDGSDIPTDRFIV-PRIEVELAFVLAKRGPNCTL
2eb4C           LKGHKIGLTSKAMQASSQ---ISEPDYGALLDDMFFHDGSDIPTDRFIV-PRIEVELAFVLAKRGPNCTL
2eb4A           LKGHKIGLTSKAMQASSQ---ISEPDYGALLDDMFFHDGSDIPTDRFIV-PRIEVELAFVLAKRGPNCTL
2eb4B           LKGHKIGLTSKAMQASSQ---ISEPDYGALLDDMFFHDGSDIPTDRFIV-PRIEVELAFVLAKPLRNCTL
2eb4D           LKGHKIGLTSKAMQASSQ---ISEPDYGALLDDMFFHDGSDIPTDRFIV-PRIEVELAFVLAKPLRNCTL
2eb6A           LKGHKIGLTSKAMQASSQ---ISEPDYGALLDDMFFHDGSDIPTDRFIV-PRIEVELAFVLAKPLRNCTL
2eb5B           LKGHKIGLTSKAMQASSQ---ISEPDYGALLDDMFFHDGSDIPTDR-FIVPRIEVELAFVLAKRGPNCTL
3dgsB           VVITGDETQVYAIWVPVGLATPIPGYIYINPLDGTYPPGTEQNPANPNPSLEESHPLNTFMFQGNRFRNR
3dgsA           YAIWVPVGLAIPENEYGDTPIPGYIYINPLD--GTYPPGTEQNPANPNPSLEESHPLNTFMFQGNRFRNR
2bh0A           --------------------------------------------------------VKAPITGNFTYRIK


                         +         .         .         .         .         *         .:210
query           KDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLVTKDEIQXXXXXXXXXXXXGHRHQT
2dfuA           EKALDHVLGYTVAVDITARDVQK-KDLQWVRAKSADKFLPLGPWLETDLNPQ---DTWVRTYVNGTLRQE
2dfuB           EKALDHVLGYTVAVDITARDVQK-KDLQWVRAKSADKFLPLGPWLETDLNPQ---DTWVRTYVNGTLRQE
2dfuD           EKALDHVLGYTVAVDITARDVQK-KDLQWVRAKSADKFLPLGPWLETDLNPQ---DTWVRTYVNGTLRQE
2eb5A           FDVYNATDYVIPALELIDARCHNIKVFDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEET
2eb5E           FDVYNATDYVIPALELIDARCHNIKVFDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEET
2eb6D           FDVYNATDYVIPALELIDARCHPRKVFDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEET
2eb4C           FDVYNATDYVIPALELIDARCHPRKVFDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEET
2eb4A           FDVYNATDYVIPALELIDARCHNIKVFDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEET
2eb4B           FDVYNATDYVIPALELIDARCHPRKVFDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEET
2eb4D           FDVYNATDYVIPALELIDARCHIRKVFDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEET
2eb6A           FDVYNATDYVIPALELIDARCHNIKVFDTISDNAANAGVILGGRPIKPDE-LDLRWISALMYRNGVIEET
2eb5B           FDVYNATDYVIPALELIDARCHPRKVFDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEET
3dgsB           QGALTVYTGT--VTQGTDPVKTY-YQYTPVSSKAMYDAYWNGKFRDVAFHSGFNEDPLVA-------EYQ
3dgsA           QGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDVAFHSGFN-------------------
2bh0A           EGSSRWWAAIQVRNHKYPVKEYE-KDGKWINEKDYNHFVSTNLG---TGSLKVRT--------------D


                         .         .         .         +         .         .         .:280
query           GNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXXXXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVILE
2dfuA           GHTSQMIFSVAEILSYISTFMTLEPLDVVLTGT-------PEGVGALRPGDRLEVAVEGVGTLFTLIGPK
2dfuB           GHTSQMIFSVAEILSYISTFMTLEPLDVVLTGT-------PEGVGALRPGDRLEVAVEGVGTLFTLIGPK
2dfuD           GHTSQMIFSVAEILSYISTFMTLEPLDVVLTGT-------PEGVGALRPGDRLEVAVEGVGTLFTLIGPK
2eb5A           GVAAGVLNHPANGVAWLANKVQLEAGQIILGG-------SFTRPVPARKGDTFHVDYGNMGSISCRFV--
2eb5E           GVAAGVLNHPANGVAWLANKVQLEAGQIILGG-------SFTRPVPARKGDTFHVDYGNMGSISCRFV--
2eb6D           GVAAGVLNHPANGVAWLANKVQLEAGQIILGG-------SFTRPVPARKGDTFHVDYGNMGSISCRFV--
2eb4C           GVAAGVLNHPANGVAWLANKVQLEAGQIILGG-------SFTRPVPARKGDTFHVDYGNMGSISCRFV--
2eb4A           GVAAGVLNHPANGVAWLANKVQLEAGQIILGG-------SFTRPVPARKGDTFHVDYGNMGSISCRFV--
2eb4B           GVAAGVLNHPANGVAWLANKVQLEAGQIILGG-------SFTRPVPARKGDTFHVDYGNMGSISCRFV--
2eb4D           GVAAGVLNHPANGVAWLANKVQLEAGQIILGG-------SFTRPVPARKGDTFHVDYGNMGSISCRFV--
2eb6A           GVAAGVLNHPANGVAWLANKVQLEAGQIILGG-------SFTRPVPARKGDTFHVDYGNMGSISCRFV--
2eb5B           GVAAGVLNHPANGVAWLANKVQLEAGQI-------ILGGSFTRPVPARKGDTFHVDYGNMGSISCRFV--
3dgsB           GQLSYLPQPP------------------------------------------------------------
3dgsA           ----------------------------------------------------------------------
2bh0A           IRGKVVKDTIPKLPESGTSKAYTVPGHV------------------------------------------


                         .         *         .         .         .         .         +:350
query           Q
2dfuA           E
2dfuB           E
2dfuD           E
2eb5A           -
2eb5E           -
2eb6D           -
2eb4C           -
2eb4A           -
2eb4B           -
2eb4D           -
2eb6A           -
2eb5B           -
3dgsB           -
3dgsA           -
2bh0A           -