[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21667.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bwpA.bssp"
#ERROR : Can't open dsspfile "3dt9A.bssp"
#ERROR : Can't open dsspfile "1bwqA.bssp"
#ERROR : Can't open dsspfile "1bwrA.bssp"
#ERROR : Can't open dsspfile "3dc7A.bssp"
#ERROR : Can't open dsspfile "3bzwA.bssp"
#ERROR : Can't open dsspfile "3dt8A.bssp"
#ERROR : Can't open dsspfile "3bzwF.bssp"
#ERROR : Can't open dsspfile "3dciA.bssp"
#ERROR : Can't open dsspfile "3dc7B.bssp"
#ERROR : Can't open dsspfile "3bzwB.bssp"
#ERROR : Can't open dsspfile "3dc7C.bssp"
#ERROR : Can't open dsspfile "1deoA.bssp"
#ERROR : Can't open dsspfile "3c1uA.bssp"

## Summary of PDB Search
:204
    4e-21  11%  1bwpA  [x.x.x] PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
    2e-20  14%  3dt9A  [x.x.x] BRAIN PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
    4e-20  13%  1bwqA  [x.x.x] PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
    1e-19  12%  1bwrA  [x.x.x] PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
    3e-19  17%  3dc7A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323
    5e-19  15%  3bzwA  [x.x.x] PUTATIVE LIPASE
    7e-19  11%  3dt8A  [x.x.x] BRAIN PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
    9e-19  16%  3bzwF  [x.x.x] PUTATIVE LIPASE
    4e-18  19%  3dciA  [x.x.x] ARYLESTERASE
    5e-18  16%  3dc7B  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323
    9e-18  15%  3bzwB  [x.x.x] PUTATIVE LIPASE
    6e-16  16%  3dc7C  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323
    1e-13  18%  1deoA  [c.23.10] RHAMNOGALACTURONAN ACETYLESTERASE
    1e-13  17%  3c1uA  [x.x.x] RHAMNOGALACTURONAN ACETYLESTERASE
:204

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxNVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGST
1bwpA           -----------------------EVVFIGDSAVQLMHQCE----------IWRELFSPLHALNFGIGGDS
3dt9A           -----------------------EVVFIGDSLVQLMHQSE----------IWRELFSPLHALNFGIGGDS
1bwqA           -----------------------EVVFIGDSLVQLMHQCE----------IWRELFSPLHALNFGIGGDS
1bwrA           -----------------------EVVFIGDSLVQLMHQCE----------IWRELFSPLHALNFGIGGDS
3dc7A           -----------------------RPAWLGDSITANNGLA-TVHYHDILAADWDV----ERSDNLGISGST
3bzwA           ------------------------VGYIGDSITDPNCYDNIKKYWDFLKEWLGIT-----PFVYGISGRQ
3dt8A           -----------------------EVVFIGDLVQLMHQSEIWREL-----------FSPLHALNFGIGGDS
3bzwF           ------------------------VGYIGDSITDPNN---IKKYWDFLKEWLG-----ITPFVYGISGRQ
3dciA           ------------------------VLAFGDSLTWGADPATGLRWPDVLEAELAG---KAKVHPEGLGGRT
3dc7B           ------------------------PAWLGDSITANNGLA-TVHYHDILAADWDV----ERSDNLGISGST
3bzwB           ------------------------VGYIGDSITDPNCYDNIKKYWDFLKEWLGIT-----PFVYGISGRQ
3dc7C           -----------------------RPAWLGDSITANNGLA-TVHYHDILAADWDV----ERSDNLGISGST
1deoA           ------------------------VYLAGDSTMAKNGGGSGTNWGEYLASYLSATVVNDAV-----AGRS
3c1uA           ------------------------VYLAGDSTMAKNGGGSGTNG----WGEYLASYLSATVVNDAVAGRS


                         .         .         *         .         .         .         .:140
query           SAGGLNRVEWSLSQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAKLKNIEIILAGMIAPTTHGIS
1bwpA           TQHVLWRLENGELEHIRPKIVV-VWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHP
3dt9A           TQHVLWRLENGLEHIRPKIVVVWVGTNNH--GHTAEQVTGGIKAIVQLVNERQARVVVLGLLPRGNPLRE
1bwqA           TQHVLWRLENGLEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNP
1bwrA           TQHVLWRLENGEEHIRPKIVVVWVGSNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNP
3dc7A           IGSRYDAARYQAIPEDADFIAVFGGVNDYGRDQPLGQYGDCDTTFYGALLLTGLQTNWPTFISAIHIGSD
3bzwA           WDDVPRQAEKLKEHGGEVDAILVFGTNDYNSSVTQDTYRGRINIGITQLKKLFPDKQIVLLTPLHRSLAN
3dt8A           TQHVLWRLNGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNP
3bzwF           WDDVPRQAEKLKEHGGEVDAILVFGTNDYNSSVTQDTYRGRINIGITQLKKLFPDKQIVLLTPLHRSLAE
3dciA           TCYDDHAGPACRNGARALDLVIILGTNDIKPVHSGRRLAQIVETFIYKPREAVPKLLIAGPGGEPAGGRD
3dc7B           IGSRYDAAVRYAIPEDADFIAVFGGVNDYGRDQPLGQYGDCDTTFYGQTNWPTVPKLFISAIHIGSFGGS
3bzwB           WDDVPRQAEKLKEHGGEVDAILVFGTNDYNSSVTQDTYRGRINIGITQLKKLFPDKQIVLLTPLHRSLGE
3dc7C           IGSRYDAAVRYQIPEDADFIAVFGGVNDYGRDQPLGQYGDCDTTFYGALLLTGLQLFISAIHIGSDFGGS
1deoA           ARSYTREGRFEDVVTAGDYVIVEFGHNDGGSLSTILTFPAYLENAAKLFTAKGAKVILSSQPWETGTFVN
3c1uA           ARSYTREGRFEDVVTAGDYVIVEFGHNDGGVNETILTFPAYLENAAKLFTAKGAKVILSSQPWETGTFVN


                         +         .         .         .         .         *         .:210
query           YKKKFDNIYPSLAQKYELNLIPFLLEGVALKPELNQEDGMHPNEKGTIIISDTLTKSIINFIKx
1bwpA           NPLRNELVRAALAGHPRAHFLDAFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL--
3dt9A           KNRRVNELVRAALAGHPLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRAL----------
1bwqA           LREKNRRVNELVRAALALDADPGFVHSDGTISHHDMYDYAHLSRLGYTPVCRALHSLLLRLL--
1bwrA           LREKNRRVNELVAGHPRAHFLPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL--
3dc7A           FGGSFSAVTNGLGYRQSDYYRDAGTFAIPAQAAIYSVDTLHPNNAGHRVIARKLQSFLDSHFL-
3bzwA           FGDAYVQAIKEAGNIWGIPVIDFPVEEQLIYFYDAGYDRLHPDTKGQERARTLYQLLAL-----
3dt8A           LREKNRRVNELVAGHPRAHFLDGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL--
3bzwF           YIDAYVQAIKEAGNIWGIPVIDFPVEEQLIYFYDAGYDRLHPDTKGQERARTLYQLLA------
3dciA           EQSRLAPLYRKLAAELGHHFFDA-----GSVASASPVDGVHLDASATAAIGRALAAPV------
3dc7B           FSAVTNGLGYRQSDYEAALYRDAGTFAIPAQAAIYSVDTLHPNNAGHRVIARKLQSFL------
3bzwB           YIDAYVQAIKEAGNIWGIPVIDFPVEEQLIYFYDAGYDRLHPDTKGQERARTLYQLLAL-----
3dc7C           FSAVTNGLGYRQSDYEAALYRDAGTFAIPAQAAIYSVDTLHPNNAGHRVIARKLQSFLDS----
1deoA           SPTRFVEYAELAAEVAGVEYVDHETLGNATVNSYFPIDHTHTSPAGAEVVAEAFLKAV------
3c1uA           SPTRFVEYAELAAEVAGVEYVDHETLGNATVNSYFPINHTHTSPAGAEVVAEAFLKAV------