[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21852.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2b3zA.bssp"
#ERROR : Can't open dsspfile "2b3zD.bssp"
#ERROR : Can't open dsspfile "2b3jA.bssp"
#ERROR : Can't open dsspfile "2b3jD.bssp"
#ERROR : Can't open dsspfile "3bjqJ.bssp"
#ERROR : Can't open dsspfile "2b3jC.bssp"
#ERROR : Can't open dsspfile "3b8fA.bssp"
#ERROR : Can't open dsspfile "3b8fC.bssp"
#ERROR : Can't open dsspfile "3e1uA.bssp"
#ERROR : Can't open dsspfile "2a8nA.bssp"
#ERROR : Can't open dsspfile "3dgaB.bssp"
#ERROR : Can't open dsspfile "2ab1A.bssp"
#ERROR : Can't open dsspfile "3dh1B.bssp"
#ERROR : Can't open dsspfile "3b8fB.bssp"
#ERROR : Can't open dsspfile "3dh1A.bssp"
#ERROR : Can't open dsspfile "3dh1D.bssp"
#ERROR : Can't open dsspfile "2ahuA.bssp"
#ERROR : Can't open dsspfile "3dmoA.bssp"
#ERROR : Can't open dsspfile "1dioB.bssp"
#ERROR : Can't open dsspfile "2blaA.bssp"
#ERROR : Can't open dsspfile "1egmE.bssp"
#ERROR : Can't open dsspfile "3dmoB.bssp"
#ERROR : Can't open dsspfile "3dgaA.bssp"
#ERROR : Can't open dsspfile "2d30A.bssp"
#ERROR : Can't open dsspfile "2blbA.bssp"
#ERROR : Can't open dsspfile "2aznA.bssp"
#ERROR : Can't open dsspfile "2bl9A.bssp"
#ERROR : Can't open dsspfile "3clbB.bssp"
#ERROR : Can't open dsspfile "2ab1B.bssp"
#ERROR : Can't open dsspfile "1af2A.bssp"
#ERROR : Can't open dsspfile "3clbD.bssp"
#ERROR : Can't open dsspfile "3cl9A.bssp"
#ERROR : Can't open dsspfile "3clbA.bssp"
#ERROR : Can't open dsspfile "1dysA.bssp"
#ERROR : Can't open dsspfile "3clbC.bssp"
#ERROR : Can't open dsspfile "2blcA.bssp"
#ERROR : Can't open dsspfile "2a8nB.bssp"
#ERROR : Can't open dsspfile "1ai9A.bssp"
#ERROR : Can't open dsspfile "1dhfA.bssp"
#ERROR : Can't open dsspfile "3dl5A.bssp"
#ERROR : Can't open dsspfile "3dl5B.bssp"
#ERROR : Can't open dsspfile "1cz3B.bssp"
#ERROR : Can't open dsspfile "3dl6B.bssp"
#ERROR : Can't open dsspfile "3e0bA.bssp"
#ERROR : Can't open dsspfile "1dyrA.bssp"
#ERROR : Can't open dsspfile "1ddqC.bssp"
#ERROR : Can't open dsspfile "3dl6A.bssp"

## Summary of PDB Search
:351
    5e-48  32%  2b3zA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    8e-47  32%  2b3zD  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    1e-21  27%  2b3jA  [x.x.x] TRNA ADENOSINE DEAMINASE
    2e-21  27%  2b3jD  [x.x.x] TRNA ADENOSINE DEAMINASE
    6e-21   5%  3bjqJ  [x.x.x] PHAGE-RELATED PROTEIN
    9e-21  27%  2b3jC  [x.x.x] TRNA ADENOSINE DEAMINASE
    1e-20  10%  3b8fA  [x.x.x] PUTATIVE BLASTICIDIN S DEAMINASE
    3e-20  10%  3b8fC  [x.x.x] PUTATIVE BLASTICIDIN S DEAMINASE
    4e-19  10%  3e1uA  [x.x.x] DNA DC->DU-EDITING ENZYME APOBEC-3G
    5e-19  25%  2a8nA  [x.x.x] CYTIDINE AND DEOXYCYTIDYLATE DEAMINASE
    3e-18  11%  3dgaB  [x.x.x] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    4e-18  15%  2ab1A  [x.x.x] HYPOTHETICAL PROTEIN
    9e-18  28%  3dh1B  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    9e-18  10%  3b8fB  [x.x.x] PUTATIVE BLASTICIDIN S DEAMINASE
    1e-17  28%  3dh1A  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    2e-17  27%  3dh1D  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    6e-17   7%  2ahuA  [x.x.x] PUTATIVE ENZYME YDIF
    1e-16  13%  3dmoA  [x.x.x] CYTIDINE DEAMINASE
    2e-16  14%  1dioB  [c.51.3] PROTEIN (DIOL DEHYDRATASE)
    2e-16  11%  2blaA  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    7e-16   8%  1egmE  [c.51.3] PROPANEDIOL DEHYDRATASE
    2e-15  16%  3dmoB  [x.x.x] CYTIDINE DEAMINASE
    4e-15  10%  3dgaA  [x.x.x] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    4e-15  11%  2d30A  [x.x.x] CYTIDINE DEAMINASE
    6e-14   8%  2blbA  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    8e-14  25%  2aznA  [x.x.x] PUTATIVE 5-AMINO-6-(5-PHOSPHORIBOSYLAMINO)URACIL
    8e-14   8%  2bl9A  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    1e-13  12%  3clbB  [x.x.x] DHFR-TS
    2e-13  18%  2ab1B  [x.x.x] HYPOTHETICAL PROTEIN
    2e-13  16%  1af2A  [c.97.1 - c.97.1] CYTIDINE DEAMINASE
    9e-13  12%  3clbD  [x.x.x] DHFR-TS
    2e-11  11%  3cl9A  [x.x.x] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    6e-11  11%  3clbA  [x.x.x] DHFR-TS
    8e-11  16%  1dysA  [c.6.1] ENDOGLUCANASE
    1e-10  10%  3clbC  [x.x.x] DHFR-TS
    2e-10   8%  2blcA  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    5e-10  17%  2a8nB  [x.x.x] CYTIDINE AND DEOXYCYTIDYLATE DEAMINASE
    8e-09  16%  1ai9A  [c.71.1] DIHYDROFOLATE REDUCTASE
    8e-09  15%  1dhfA  [c.71.1] DIHYDROFOLATE REDUCTASE
    8e-09  17%  3dl5A  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    1e-07  19%  3dl5B  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    2e-07  16%  1cz3B  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-07  14%  3dl6B  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    4e-06  18%  3e0bA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-05   9%  1dyrA  [c.71.1 (1e26A)] DIHYDROFOLATE REDUCTASE
    4e-05   8%  1ddqC  [x.x.x] DNA-DIRECTED RNA POLYMERASE
    7e-05  15%  3dl6A  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
:351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGSKMYVTLEPCS
2b3zA           MKLALDLAKQGEGQTESNPLVGAVVVKDGQIVGMGAHLKYGEAHAEVHAIHMAGAHAEGADIYVTLEPCS
2b3zD           MKLALDLAKQGEGQTESNPLVGAVVVKDGQIVGMGAHLKYGEAHAEVHAIHMAGAHAEGADIYVTLEPCS
2b3jA           MTLAIEEAKK--AAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAKVLGSWRLEGCTLYVTLEPCV
2b3jD           MTLAIEEAKK--AAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAKVLGSWRLEGCTLYVTLEPCV
3bjqJ           ----------------------------------------------------------------------
2b3jC           MTLAIEEAKK--AAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAKVLGSWRLEGCTLYVTLEPCV
3b8fA           YDVVKQLIEQR---YPNDWGGAAAIRVEDGTIYTSVINASTELCMETGAILEFQKKVTHSICLARENEHS
3b8fC           YDVVKQLIEQR---YPNDWGGAAAIRVEDGTIYTSVINASTELCMETGAILEFQKKVTHSICLARENEHS
3e1uA           TYLCYEVER-MHNDTWVLLNQRRGFLCNQ---APHKHGFLEGRHAELCFLDVDLDQDYRVTCFTSWSPCF
2a8nA           MELALVEARS--AGERDEVPIGAVLVLDGRVIARSGNRNDVTAHAEIAVIRMGQERLPGADLYVTLEPCT
3dgaB           ----------------------------------------------------------------------
2ab1A           ---------------------------SPEIASLSWGQKVSNTTYKDCKVWPG-----GSRTWDWRETGT
3dh1B           MEEAMHMAKE--ALENTEVPVGCLMVYNNEVVGKGNQTKNATRHAEMVAIDQVLDWFEHTVLYVTVEPC-
3b8fB           YDVVKQLIEQR---YPNDWGGAAAIRVEDGTIYTSVINASTELCMETGAILEFQKKVTHSICLARENEHS
3dh1A           MEEAMHMAKE--ALENTEVPVGCLMVYNNEVVGKGNQTKNATRHAEMVAIDQVLDWFEHTVLYVTVEPCI
3dh1D           MEEAMHMAKE--ALENTEVPVGCLMVYNNEVVGKGNQTKNATRHAEMVAIDQVLDWCRHTVLYVTVEPC-
2ahuA           -----------------------YIPDEATLCVLGAGGGILEATTLITALADKYKQTQTPRNLSIISPTG
3dmoA           -----------------NFKVGAALVTNDGKVFHGNASYGLCNCAERTALFSALAAGYRPGEFAAIAVVG
1dioB           ----------------------------------------------------------------------
2blaA           ----------------------------------------------------------------------
1egmE           ----------------------------------------------------------------------
3dmoB           -----------------NFKVGAALVTNDGKVFHGNASYGLCNCAERTALFSALAAGVVGETHGPIAPC-
3dgaA           ----------------------------------------------------------------------
2d30A           IQEAIEARKQAYVPYS-KFQVGAALLTQDGKVYRGNASYGLCNCAERTALFKAVSEGDKVAIAIVADTKR
2blbA           ----------------------------------------------------------------------
2aznA           ----------------------------------------------------------------------
2bl9A           ----------------------------------------------------------------------
3clbB           ----------------------------------------------------------------------
2ab1B           -----------------------------------------STSPEIASLSWGQKVKGS---NTTYKDCK
1af2A           LPLAAACARTPLS----NFNVGAIARGVSGTWYFGANMMQQTVHAEQSAISHLSGEKALAAITVNYTPC-
3clbD           ----------------------------------------------------------------------
3cl9A           ----------------------------------------------------------------------
3clbA           ----------------------------------------------------------------------
1dysA           IDVAIQNARA--AKARGENPIVGLVLYNLPDLKLSQNGLNRYKNEYVNPFAQKLKAASDVQFAVILEPGN
3clbC           ----------------------------------------------------------------------
2blcA           ----------------------------------------------------------------------
2a8nB           MELALVEARS--AGERDEVPIGAVLVLDGRVIARSGELNDVTAHAEIAVIRMACEALGQERLPGADLYV-
1ai9A           ----------------------------------------------------------------------
1dhfA           ----------------------------------------------------------------------
3dl5A           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
1cz3B           ----------------------------------------------------------------------
3dl6B           ----------------------------------------------------------------------
3e0bA           ----------------------------------------------------------------------
1dyrA           ----------------------------------------------------------------------
1ddqC           ----------------------------------------------------------------------
3dl6A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           HYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNILVKKDLLKKQINKFYAPYFFNRKKNL
2b3zA           HYGKTPPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEAGIEVREGILADQAERLNEKFLHFMRTGL
2b3zD           HYGKTPPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEAGIEVREGILADQAERLNEKFLHFMRTGL
2b3jA           M------CAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFIVDKGVLKEACSTLLTTFFKNLRAN-
2b3jD           M------CAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFIVDKGVLKEACSTLLTTFFKNLRAN-
3bjqJ           -----------------------------------------RQSTLIGKKLFPVAPVAQYGGKILTFGKE
2b3jC           M------CAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFIVDKGVLKEACSTLLTTFFKNLRAN-
3b8fA           ELKVLSPCQERLFYWGPEVQCAITNAKQDIIFKPLKELQPYHWTEAYHDEMVKE----------------
3b8fC           ELKVLSPCQERLFYWGPEVQCAITNAKQDIIFKPLKELQPYHWTEAYHDEMVKE----------------
3e1uA           SCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQ
2a8nA           M------CAAAISFARIRRLYYGAQDPKGGAVESGVRFFSQPTCHHA-----------------------
3dgaB           -----------------------------------------------EQVCDVFDIYAICACCKVESKNE
2ab1A           EHGVQPADVKEVVEKGVQTLVIGRGSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGG
3dh1B           -----IMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIATGRPFQCIPGYRAEEAVEMLKTFY-------
3b8fB           ELKVLSPCQERLFYWGPEVQCAITNAKQDIIFKPLKELQPYHWTEAYHDEMVKE----------------
3dh1A           M------CAAALRLMKIPLVVYGCQNERFGGCGSVLNIATGRPFQCIPGYRAEEAVEMLKTFY-------
3dh1D           -----IMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIATGRPFQCIPGYRAEEAVEMLKTFY-------
2ahuA           LGDRADRGISPLAQEGLVKWALCGHWGQSPRISDLAEQNKIIAYNYPQGVLLRAAAAHQPGIISDIGIGT
3dmoA           ETHGPGACRQVMIELGKPTLEVVLTNMQGDVRVTSAGDL-------------------------------
1dioB           ------------------EVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGI---KARVIRCFKS
2blaA           -----------------------------------------------ENLSDVFDIYAICACCKVAPTSE
1egmE           ----------------------GEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAIEEEGI
3dmoB           -----GACRQVMIELGKPTLEVVLTNMQGDVRVTSAGDL-------------------------------
3dgaA           --------------------------------------------------MMEQVCDVFDIYAICESKNE
2d30A           PVPPCGACRQVMVELCKQDTKVYLSNLHGDVQETTVGEL-------------------------------
2blbA           ----------------------------------------------------------ICACCKVAPTSA
2aznA           -------------------------------------------------------------------EKK
2bl9A           -----------------------------------------------ENLSDVFDIYAICACCKVAPTSA
3clbB           -------------------------------------------------LFKIRMPE---TVAEGTRLAL
2ab1B           VWGVQPADVKEVVEKGVQTLVIGRGSEALKVPSSTVEYLKKHGIDVRVLQTEKEYNAL----VAQGVR--
1af2A           -----GHCRQFMNELNSGLDLRIRDYLPDAFGPKDLEIKTLLMDEQDHGYALTGDALSQAAIAAANRSHM
3clbD           ------------------------------------------------SLFKIRMPE---TVAEGTRLAL
3cl9A           ------------------------------------------------------------TVAEGTRLAL
3clbA           -----------------------------------------------------------ETVAEGTRLAL
1dysA           MVTGTSAFCRNARGPQQEAIGYAISQLQASHIHLYLDVANGGWAQEVATILQKAGNNAKIRGFSSNVSNY
3clbC           --------------------------------------------------MSLFKIRMPETVAEGTRLAL
2blcA           ----------------------------------------------------ENLSDVFCACCKVAPTSE
2a8nB           TLEPCTMCAAAISFARIRRLYYGAQDPKGGAVESGVRFFSHHAPDVYSGLAESE----------------
1ai9A           --------------------------------------------------------------------LK
1dhfA           ----------------------------------------------------------------------
3dl5A           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
1cz3B           ----------------------------------------------------------------------
3dl6B           ----------------------------------------------------------------------
3e0bA           ----------------------------------------------------------------------
1dyrA           ----------------------------------------------------------------------
1ddqC           --------------------------QAAFKETFPIEEGDKGKGGLVLDFLEYRIGDPPFSQDECREKDL
3dl6A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PYVTGKIAISKNNLIYSKDTKRISDIHTDRFTHFLRYKNDSLMISSKTLNKDDPKLNCRLEGLSKFSPKR
2b3zA           PYVTLKAAASLDGKISTGDSKWITSEAARQDAQQYRKTHQSILVGVGTVKADNPSLTCRLPNVTK-QPVR
2b3zD           PYVTLKAAASLDGKIATSTGDSITSEAARQDAQQYRKTHQSILVGVGTVKADNPSLTCRLPNVTK-QPVR
2b3jA           ----------------------------------------------------------------------
2b3jD           ----------------------------------------------------------------------
3bjqJ           AFRLYNTKRTKRIDFGYEGDSIVPSALEAKVPRELRDASQVPGIDLGARSVNTVLRIALAHEHECAQDPA
2b3jC           ----------------------------------------------------------------------
3b8fA           ----------------------------------------------------------------------
3b8fC           ----------------------------------------------------------------------
3e1uA           PWDGLDEHSQ------------------------------------------------------------
2a8nA           ----------------------------------------------------------------------
3dgaB           GKKNEVFNNYTFRGLGNKG--VLPWKCNSLDMKYFCAVTTYVNESKYEKLKYKRCKYLNKETVDNSKQNV
2ab1A           VFHS------------------------------------------------------------------
3dh1B           ----------------------------------------------------------------------
3b8fB           ----------------------------------------------------------------------
3dh1A           ----------------------------------------------------------------------
3dh1D           ----------------------------------------------------------------------
2ahuA           FVDPRQQGGKLNEVTKEDLIKLVEAIAPDIFIRATTCDSEGYATFEDEVYLDALVI-AQAVHNNGGIVQV
3dmoA           ----------------------------------------------------------------------
1dioB           SDVAAVEGNSGSGISIGIQSKGTTVIH---QQGLPPLSNLELFPQAPLLTLETYRQIGRYAKRESPQPVP
2blaA           GTKNEPFSPRTFRGLGNKG--TLPWKCNSVDMKYFRSVTTYVDESKYEKLKWKRERYLRMNADKL--QNV
1egmE           KARVIRCDVAFVAVEGNRLSGSIQSKGTTHQQGLPPLSNLELFPQAPLLTLETYRQIGRYAKRESPQPVP
3dmoB           ----------------------------------------------------------------------
3dgaA           GKKNEVFNNYTFRGLNKGVLPWKCNSLDMKYFCAVTTYVNESKYEKLKYKRCKYLNKEK----KLQNVVV
2d30A           ----------------------------------------------------------------------
2blbA           GTKNEPFSPRTFRGLNKGTLPWKCNSVDMKYFSSVTTYVDESKYEKLKWKRERYLRMEASK---LQNVVV
2aznA           PYII-SNVGTLDGKLATINNDRISCEEDLIRVHKIRANVDGIV-GIGTVLKDDPRLTVHKIKSDR-NPVR
2bl9A           GTKNEPFSPRTFRGLNKGTLPWKCNSVDMKYFSSVTTYVDESKYEKLKWKRERYLRMEAKLQN----VVV
3clbB           RAFSLVVAVDERGGIDMKFFRDVTTKLRGKNVKPSPAKRNAVVMGRKTWDSIPPKFRPLPG------RLN
2ab1B           ----------------------------------------------------------------------
1af2A           PYSKSPSGVA------------------------------------------------------------
3clbD           RAFSLVVAVDERGGIGDGRSRDVTTKLRGKNVKPSPAKRNAVVMGRKTWD-SIPPKFRPLPG-----RLN
3cl9A           RAFSLVVAVDERGGIGDGRSRDVTTKLRGKNVKPSPAKRNAVVMGRKTWDSIPPKFRPLP------GRLN
3clbA           RAFSLVVAVDERGGIGDGRSRDVTTKLRGKNVKPSPAKRNAVVMGRKTWDSIPPKFRPLPG------RLN
1dysA           PYST------------------------------------------------------------------
3clbC           RAFSLVVAVDERGGIGDGRSRDVTTKLRGKNVKPSPAKRNAVVMGRKTWDSIPPKFRPL------PGRLN
2blcA           GTKNEPFSPRTFRGLNKGTLPWKCNSVDMKYFRSVTTYVDESKYEKLKWKRERYLRMEK--------LQN
2a8nB           ----------------------------------------------------------------------
1ai9A           PNVAIIVAALKPALGIGYKRKEIRYFKDVTTRTTKPNTRNAVIMGRKTWESI-PQKFRPLPD-----RLN
1dhfA           --LNCIVAVSQNMGIKNGDLPWPPYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNR-PLKG-----RIN
3dl5A           -------------------------------------KNVSIVVAASVLSSGNGQLPWSISEDLKF-FSK
3dl5B           -------------------------------------KNVSIVVAASVLSSGNGQLPWSISEDLKF-FSK
1cz3B           --VIFVLAMDVSGKIASSV----ESWSSRKNFRKITTEIGNVVMGRITFEEIGRPLPERL---------N
3dl6B           -------------------------------ISEDLKFFSKITNNKCDSNKKNALIMGRKTWDS--IGRR
3e0bA           MRVSFMVAMDENRVI-GKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRR---------N
1dyrA           KSLTLIVALTTSYGIGRSNPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRKTWESIPQFRPLKGRIN
1ddqC           TYQAPLYARLQLIHKDTGLIKEDEVFLGHLPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRY
3dl6A           -------------------------------ISEDLKFFSKITNNKCDSNKKNALIMGRKTWDS--IGRR


                         .         .         .         +         .         .         .:280
query           IILDRNLEIKKNSYIFKTANKDNTIIFYYNAKAEVKLMLKKKGITLIKSKLNKNSFDIKSILMKLYVLGC
2b3zA           VILDTVLSIPEDAKVICDQIAPTWIFTTARADEEKKKRLSAFGVNIFTLETER--IQIPDVLKILAEEGI
2b3zD           VILDTVLSIPEDAKVICDQIAPTWIFTTARADEEKKKRLSAFGVNIF--TLETERIQIPDVLKILAEEGI
2b3jA           ----------------------------------------------------------------------
2b3jD           ----------------------------------------------------------------------
3bjqJ           KYNADHKVKLVGSARWTSPDS--DPTKDVETAKEAIADSIGEPNRLLSRKYHPKLIERAESITIDLKALW
2b3jC           ----------------------------------------------------------------------
3b8fA           ----------------------------------------------------------------------
3b8fC           ----------------------------------------------------------------------
3e1uA           ----------------------------------------------------------------------
2a8nA           ----------------------------------------------------------------------
3dgaB           VVMGRTSWESIPKKFKPLSNRIN-VILSRTLKKE----DFDEDVYIINK--------VEDLIVLLGKLNY
2ab1A           ----------------------------------------------------------------------
3dh1B           ----------------------------------------------------------------------
3b8fB           ----------------------------------------------------------------------
3dh1A           ----------------------------------------------------------------------
3dh1D           ----------------------------------------------------------------------
2ahuA           QKVKKATLHPKSVRIPGYLVDIVVVDPDQSQLYGGAPVNRFISGDFTLDLPLNQRKLVARRALFERKGAV
3dmoA           ----------------------------------------------------------------------
1dioB           TLNDQMARPKYQAKSAILHIK-ETKYVVTGKNPQEL----------------------------------
2blaA           VVMGRSNWESIPKQYKPLPNRI-NVVLSKTLTKE----DVKEKVFIID--------SIDDLLLLLKKLKY
1egmE           TLNDQMARPKYQAKSAILHIK-ETKYVVTGKNPQEL----------------------------------
3dmoB           ----------------------------------------------------------------------
3dgaA           MGRTSWESIPKKFKPLSNRI---NVILSRTLKKE----DFDEDVYIINK--------VEDLIVLLGKLNY
2d30A           ----------------------------------------------------------------------
2blbA           MGRSSWESIPKQYKPLPNR---INVVLSKTLTKE----DVKEKVFIID--------SIDDLLLLLKKLKY
2aznA           IVVDSKLRVPLNARVLNKD--AKTIIATTEDTNEEK----EKKIKILEDGVEVVKCVDLKKLDILYDKGI
2bl9A           MGRSSWESIPKQYKPLPNRI---NVVLSKTLTKE----DVKEKVFIID--------SIDDLLLLLKKLKY
3clbB           VVLSSTLTTQHLLDGLPDEADSIVAVN------------------------GGLEQALQLLASPNYTPSI
2ab1B           ----------------------------------------------------------------------
1af2A           ----------------------------------------------------------------------
3clbD           VVLSSTLTTQHLLDGLPDHADSIVAVNGGLEQA------------------------LQLLASPNYTPSI
3cl9A           VVLSSTLTTQHLLDNLHADS----------------------IVAVNGG----LEQALQLLASPNYTPSI
3clbA           VVLSSTLTTQHLLDGLPDEHADSIVAVNGGLEQ-----------------------ALQLLASPNYTPSI
1dysA           ----------------------------------------------------------------------
3clbC           VVLSSTLTTQHLLDGLPDEHADSIVAVNGGLEQ-----------------------ALQLLASPNYTPSI
2blcA           VVVMGRSNWESIPKQYKPLPNRINVVLSKTLTKE----DVKEKVFIIDS--------IDDLLLLLKKLKY
2a8nB           ----------------------------------------------------------------------
1ai9A           IILSRSYEN----------EIIDDNIIHASSIESSLNLVSD----------------------------V
1dhfA           LVLSREL---------KEPPQGAHFLS-----------------RSLDD-------ALKLTEQPELANKV
3dl5A           ITNNKCDSNKKNALIMKTWDSIGRRPLKVVISSSLPQDEADPNVVVFRN-------LEDSIENLMNDDSI
3dl5B           ITNNKCDSNKKNALIMKTWDSIGRRPLKNRIIVVIPQDEADPNVVVFRN-------LEDSIENLMNDDSI
1cz3B           VVLTRRPKTSNNPSLVFFNG------------------------------------SPADVVKFLEGKGY
3dl6B           PLKNRIIVVISSSLPQDEADPNVVVF---------------------------RNLE-DSIENLMNDDSI
3e0bA           IIVTRNEGYHVEGCEVAH----------------------------------------------------
1dyrA           VVITRNESLDLGNGIHSAKSLDHALEL------------------------------LYRTYGSESSVQI
1ddqC           IASIIPLPKRGPWIDLEVEASGVVTMKVNKRKFPLVLLLRVLGYDQETLVRELSAYGDLVQGLLDEAVLA
3dl6A           PLKNRIIVVISSSLPQDEADPNVVVF--RNLEDSIENLMNDDSI--------------------------


                         .         *         .         .         .         .         +:350
query           RNLLVEGGNDLSKHIIKKKLFNEFYLYKCSKSLSKLVNHKEFGFxxxxxxxxxxxxxxxxxxxxxxxxxx
2b3zA           MSVYVEGGSAVHGSFVKEGCFQEIIFYFAPKLI-------------------------------------
2b3zD           MSVYVEGGSAVHGSFVKEGCFQEIIFYFAPKLI-------------------------------------
2b3jA           ----------------------------------------------------------------------
2b3jD           ----------------------------------------------------------------------
3bjqJ           EVEEIVVGTARVATGANDSFGDVWGPD-------------------------------------------
2b3jC           ----------------------------------------------------------------------
3b8fA           ----------------------------------------------------------------------
3b8fC           ----------------------------------------------------------------------
3e1uA           ----------------------------------------------------------------------
2a8nA           ----------------------------------------------------------------------
3dgaB           YKCFIIGGSVVYQEFLEKKLIKKIYFTRINSTYEQIISVSDVY---------------------------
2ab1A           ----------------------------------------------------------------------
3dh1B           ----------------------------------------------------------------------
3b8fB           ----------------------------------------------------------------------
3dh1A           ----------------------------------------------------------------------
3dh1D           ----------------------------------------------------------------------
2ahuA           GNVGVGIADGIGLVAREEGCADDFILT-------------------------------------------
3dmoA           ----------------------------------------------------------------------
1dioB           ----------------------------------------------------------------------
2blaA           YKCFIIGGAQVYRECLSRNLIKQIYFTRINGAYPRVTSVSEVY---------------------------
1egmE           ----------------------------------------------------------------------
3dmoB           ----------------------------------------------------------------------
3dgaA           YKCFIIGGSVVYQEFLEKKLIKKIYFTRINSTY-------------------------------------
2d30A           ----------------------------------------------------------------------
2blbA           YKCFIIGGAQVYRECLSRNLIKQIYFTRINGAYPRVTSVSEVY---------------------------
2aznA           KSILLEGGGTLNW-GFKEGLVDEVSVYIAPKIF-------------------------------------
2bl9A           YKCFIIGGAQVYRECLSRNLIKQIYFTRINGAY-------------------------------------
3clbB           ETVYCIGGGSVYAEALRPHLLQAIYRTTIRASE-------------------------------------
2ab1B           ----------------------------------------------------------------------
1af2A           ----------------------------------------------------------------------
3clbD           ETVYCIGGGSVYAEALRPPLLQAIYRTTIRASE-------------------------------------
3cl9A           ETVYCIGGGSVYAEALRPPLLQAIYRTTIRASE-------------------------------------
3clbA           ETVYCIGGGSVYAEALRPHLLQAIYRT-------------------------------------------
1dysA           ----------------------------------------------------------------------
3clbC           ETVYCIGGGSVYAEALRPHLLQAIYRT-------------------------------------------
2blcA           YKCFIIGGAQVYRECLSRNLIKQIYFTRINGAY-------------------------------------
2a8nB           ----------------------------------------------------------------------
1ai9A           ERVFIIGGAEIYNELINNSLVSHLLITEIEHPS-------------------------------------
1dhfA           DMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDF-------------------------------------
3dl5A           ENIFVCGGESIYRDALKDNFVDRIYLTRVALEDIEFDTYFPE----------------------------
3dl5B           ENIFVCGGESIYRDALKDNFVDRIYLT-------------------------------------------
1cz3B           ERVAVIGGKTVFTEFLREKLVDELFVTVEPYVF-------------------------------------
3dl6B           ENIFVCGGESIYRDALKDNFVDRIYLTRVALEDIEFDTYFPEIP--------------------------
3e0bA           ----------------------------------------------------------------------
1dyrA           NRIFVIGGAQLYKAAMDHPKLDRIMAT-------------------------------------------
1ddqC           MRPEEAMVRLFTLLRPGDPPKKDKALAYLFGLLADPKRYD------------------------------
3dl6A           ENIFVCGGESIYRDALKDNFVDRIYLTRVALED-------------------------------------


                         .         .         .         .         *         .         .:420
query           x
2b3zA           -
2b3zD           -
2b3jA           -
2b3jD           -
3bjqJ           -
2b3jC           -
3b8fA           -
3b8fC           -
3e1uA           -
2a8nA           -
3dgaB           -
2ab1A           -
3dh1B           -
3b8fB           -
3dh1A           -
3dh1D           -
2ahuA           -
3dmoA           -
1dioB           -
2blaA           -
1egmE           -
3dmoB           -
3dgaA           -
2d30A           -
2blbA           -
2aznA           -
2bl9A           -
3clbB           -
2ab1B           -
1af2A           -
3clbD           -
3cl9A           -
3clbA           -
1dysA           -
3clbC           -
2blcA           -
2a8nB           -
1ai9A           -
1dhfA           -
3dl5A           -
3dl5B           -
1cz3B           -
3dl6B           -
3e0bA           -
1dyrA           -
1ddqC           -
3dl6A           -