[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21946.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ct6A.bssp"
#ERROR : Can't open dsspfile "3d5jB.bssp"
#ERROR : Can't open dsspfile "3cseA.bssp"
#ERROR : Can't open dsspfile "3ctgA.bssp"
#ERROR : Can't open dsspfile "3d4mA.bssp"
#ERROR : Can't open dsspfile "3c1rA.bssp"
#ERROR : Can't open dsspfile "2e7pA.bssp"
#ERROR : Can't open dsspfile "3ed3A.bssp"
#ERROR : Can't open dsspfile "3c1sA.bssp"
#ERROR : Can't open dsspfile "1aazA.bssp"
#ERROR : Can't open dsspfile "3d5jA.bssp"
#ERROR : Can't open dsspfile "1abaA.bssp"
#ERROR : Can't open dsspfile "2e7pB.bssp"
#ERROR : Can't open dsspfile "1b4qA.bssp"
#ERROR : Can't open dsspfile "1egoA.bssp"

## Summary of PDB Search
:110
    2e-16  15%  2ct6A  [x.x.x] SH3 DOMAIN-BINDING GLUTAMIC ACID-RICH-LIKE
    2e-16  29%  3d5jB  [x.x.x] GLUTAREDOXIN-2, MITOCHONDRIAL
    7e-16  18%  3cseA  [x.x.x] DIHYDROFOLATE REDUCTASE
    6e-13  22%  3ctgA  [x.x.x] GLUTAREDOXIN-2
    3e-12  23%  3d4mA  [x.x.x] GLUTAREDOXIN-2, MITOCHONDRIAL
    3e-11  26%  3c1rA  [x.x.x] GLUTAREDOXIN-1
    6e-11  28%  2e7pA  [x.x.x] GLUTAREDOXIN
    9e-11  12%  3ed3A  [x.x.x] PROTEIN DISULFIDE-ISOMERASE MPD1
    2e-10  26%  3c1sA  [x.x.x] GLUTAREDOXIN-1
    5e-10  19%  1aazA  [c.47.1] GLUTAREDOXIN
    1e-09  24%  3d5jA  [x.x.x] GLUTAREDOXIN-2, MITOCHONDRIAL
    4e-09  19%  1abaA  [x.x.x] GLUTAREDOXIN
    8e-09  29%  2e7pB  [x.x.x] GLUTAREDOXIN
    6e-08  21%  1b4qA  [c.47.1] PROTEIN (HUMAN THIOLTRANSFERASE)
    1e-07  11%  1egoA  [x.x.x] GLUTAREDOXIN
:110

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDDSTKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREGIKEFSDWP
2ct6A           ---------SSGSSGMVIRVFIASSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQEKKPTQGNP
3d5jB           VSQETVAHVKDLIGQKEVFVAAK-----TYCPYSKATLSTLQELNVPKSKALVLEGSEIQDALEEISGQK
3cseA           ---------------VPVVGIVAALLPEMGIGFQGNLPWRLAKEMKYFREVTTLTNDNSKQNIMGRKTWE
3ctgA           VSQETVAHVKDLIGQKEVFVAA-----KTYCPYCKATLSTLFQELNVPKSDEMSNGSEIQDALEEISGQK
3d4mA           VSQETVAHVKDLIGQKEVFVAAK-----TYCPYCKATLSTLFQELNVPKSDEMSNGSEIQDALEEISGQK
3c1rA           VSQETIKHVKDLIAENEIFVAS-----KTYCPYCHAALNTLFEKLKVPRSLNDMKEGADQAALYEINGQR
2e7pA           ---------------------------KTYCGYCNRVKQLLTQVGASYKVVELDDGSQLQSALAHWTGRG
3ed3A           -----------FKYLQKVIPEQRQSDKSKLVVFDADKDKFWE-----YEGNSINKNDISKFLRDTFSITP
3c1sA           VSQETIKHVKDLIAENEIFVAS-----KTYCPYCHAALNTLFEKLKVPRSKVLVEGADIQAALYEINGQR
1aazA           ----------------KVYGYDSNIH---KCVYCDNAKRLLTVKKQPFEFINIMPEKGVFDDERDTQIGL
3d5jA           VSQETVAHVKDLIGQKEVFVAAK-----TYCPYSKATLSTLFQELNVPKSDEMSNGSEIQDALEEISGQK
1abaA           -----------------FKVYGY-DSNIHKCGPCDNAKRLLTVKKQPFEFINIMPEKGVFKLGRDTQIGL
2e7pB           ---------------------------KTYCGYCNRVKQLLTQVGASYKVVELDEGSQLQSALAHWTGRG
1b4qA           --------VNSKIQPGKVVVFI-----KPTCPYSRRAQEILSQLPIKQGLLEFVHTNEIQDYLQQLTGAR
1egoA           -----------------TVIFG-----RSGCPYCVRAKDLAEKLSNERDDVDIRAEGITKEDLQQKAGKP


                         .         .         *         .         .         .         .:140
query           TIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGIxxxx
2ct6A           LPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKSG----
3d5jB           TVPNVYINGKHIGGNSDLETLKKNGKLAEILKP-------
3cseA           SIPQKFR--PLPKRINVVVSRSFDGELRKVEDGIYH----
3ctgA           TVPNVYINGKHIGGNSDLETLKKNGKLAEILKP-------
3d4mA           TVPNVYINGKHIGGNSDLETLKKNGKLAEILKP-------
3c1rA           TVPNIYINGKHIGGNDDLQELRETGELEELLE--------
2e7pA           TVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAA-----
3ed3A           NEGPFSRRSEYIAYLKTGK---------------------
3c1sA           TVPNIYINGKHIGGNDDLQELRETGELEELLE--------
1aazA           TMPQVFAPGSHIGGFDQLREYFK-----------------
3d5jA           TVPNVYINGKHIGGNSDLETLKKNGKLAEILKP-------
1abaA           TMPQVFAPGSHIGGFDQLREYFK-----------------
2e7pB           TVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAA----
1b4qA           TVPRVFIGKDSIGGSSDLVSLQQSGELLTRLKQIG-----
1egoA           VETQIFVDQQHIGGYTDFAAWVKE----------------