[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ21961.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2aniA.bssp"
#ERROR : Can't open dsspfile "2bq1I.bssp"
#ERROR : Can't open dsspfile "2av8A.bssp"
#ERROR : Can't open dsspfile "3ee4A.bssp"
#ERROR : Can't open dsspfile "3chiA.bssp"
#ERROR : Can't open dsspfile "3chhA.bssp"
#ERROR : Can't open dsspfile "3chhB.bssp"
#ERROR : Can't open dsspfile "1biqA.bssp"
#ERROR : Can't open dsspfile "3dhzA.bssp"
#ERROR : Can't open dsspfile "1biqB.bssp"
#ERROR : Can't open dsspfile "3dhiB.bssp"
#ERROR : Can't open dsspfile "3dhgB.bssp"
#ERROR : Can't open dsspfile "3dhhB.bssp"
#ERROR : Can't open dsspfile "3dhgD.bssp"
#ERROR : Can't open dsspfile "4csmA.bssp"

## Summary of PDB Search
:337
    8e-51  28%  2aniA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE BETA
    1e-47  19%  2bq1I  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 BETA
    2e-43  21%  2av8A  [a.25.1] RIBONUCLEOTIDE REDUCTASE R2
    4e-43  14%  3ee4A  [x.x.x] PROBABLE RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE
    9e-43  14%  3chiA  [x.x.x] P-AMINOBENZOATE N-OXYGENASE
    2e-40  13%  3chhA  [x.x.x] P-AMINOBENZOATE N-OXYGENASE
    3e-38  13%  3chhB  [x.x.x] P-AMINOBENZOATE N-OXYGENASE
    5e-28  20%  1biqA  [a.25.1] PROTEIN R2 OF RIBONUCLEOTIDE REDUCTASE
    4e-26  20%  3dhzA  [x.x.x] RIBONUCLEOTIDE REDUCTASE SUBUNIT R2F
    4e-22  20%  1biqB  [a.25.1] PROTEIN R2 OF RIBONUCLEOTIDE REDUCTASE
    2e-20   7%  3dhiB  [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE BETA SUBUNIT
    2e-19   6%  3dhgB  [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE BETA SUBUNIT
    1e-18   7%  3dhhB  [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE BETA SUBUNIT
    1e-14   9%  3dhgD  [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE ALPHA
    2e-10  11%  4csmA  [a.130.1] CHORISMATE MUTASE
:337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xNTKIIQPPKEEIVKPQKMGLLVENPVYKPFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQKNLTQSE
2aniA           -----VNLNSKRLVNCN----QVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELWKSDLSEDE
2bq1I           ---------------------------WNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQT-LSAAE
2av8A           --------------------MFFGQPVYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
3ee4A           ------------------------SGSLAAGWASLPLKLFAGGNAKFWHPADIDFTRDRADWEK-LSDDE
3chiA           -----------------LGRLVRAWPAVVNKADILDEWADYDTLVPDYPLEIVPFAEHPLFLQRVLTGMW
3chhA           ------------------------RAAVVNKADILDEWADYDTLVPDYPLEIVPFAEHPLFLAAELTGMW
3chhB           --------------------------AVVNKADILDEWADYDTLVPDYPLEIVPFAEHPHQRQRVLTGMW
1biqA           -SQTKNDQLKEPMFFGQPVNVAR----YDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
3dhzA           -----------------------------VIPDEKDLEVWDRLTGNFWLPEKIPVSNDIQSWNK-MTPQE
1biqB           --------------------------RYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQAL-PEHE
3dhiB           ------------------------DAFTDPDQLVYRTYNLMQDGQESYVQSLFDQFNEREHDQMV-REGW
3dhgB           ------------------------------DQLVYRTYNLMQDGQESYVQSLFDQFNEREHDQMV-REGW
3dhhB           ------------------------DAFTDPDQLVYRTYNLMQDGQESYVQSLFDQ-FNEREHDQMVREGW
3dhgD           ----------------------------EPYKT-SYPEYVSIQREKDAGAYSVKAALERAKIYENSDPGW
4csmA           ---------------------EIAHSRIRRFESPDETPFFPDKIQKSFLPSINYP-QILAPYAPENDKIK


                         .         .         *         .         .         .         .:140
query           KNLLTQIFRFFTQADVEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEYSAF
2aniA           RRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHTHTYLYICESLGLDEKEFNAY
2bq1I           QQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKEVDAAY
2av8A           KHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSFTHIIRNIVLIEMTSYWH
3ee4A           RDYATRLCTQFIAGEEAVTEDIQPFMSAMEGRLADEMYLTQFAFEEAKHTQVFRMWLDAVGISEDLHRYL
3chiA           IGYNERVIATEQLIAEPAFDLVMHGVFPGSDDPLIRKSVQQAIVDESFHTYMHMLAIDRTRELRKISERP
3chhA           IGYNERVIATEQLIAEPAFDLVMHGVFPGSDDPLIRKSVQQAIVDESFHTYMHMLAIDRTRELRKISERP
3chhB           IGYNERVIATEQLIAEPAFDLVMHGVFPGSDDPLIRKSVQQAIVDESFHTYMHMLAIDRTRELRKISERP
1biqA           KHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSFTHIIRNIVNDPSVFDDI
3dhzA           QLATMRVFTGLTLLDTIQGTVGAISLLPDAETMHEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAF
1biqB           KHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSFTHIIRNIVNDPSVVYWH
3dhiB           EHTMARCYSPLRYLFHCLQMSSAYVQQMAPAS-TISNCCILQTADSLRWLTHTAYRTHELSLTYPDAGLG
3dhgB           EHTMARCYSPLRYLFHCLQMSSAYVQQM-APASTISNCCILQTADSLRWLTHTAYRTHELSLTYPDAGLG
3dhhB           EHTMARCYSPLRYLFHCLQMSSAYVQQMAPAS-TISNCCILQTADSLRWLTHTAYRTHELSLTYPDAGLG
3dhgD           ISTLKSHYGAIAVGEYAAVTGEGRMARFSKAP-GNRNMATFGMMDELRHGQLQLFFPHEYCKKDRQFDWA
4csmA           KVYIEKIIPLISKRDGDDKNNFGSVATECLQSLSRRIHFGKFVAEAKFQIPLYTKLIKSKDVEGIM----


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXQNFDMSSKKDIALTVAVFSAFTEGLQLFASFAILLNFPRHNKMKGMGQIVTWSVRDE
2aniA           NERAAIKAKDDFQMEITGKGLQEFVKNLVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDE
2bq1I           AWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDE
2av8A           LLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
3ee4A           DDLPAYRQIFYAELPECLNSPAAQVRASVTYNHIVEGMLALTGYYAWHKICVRAILPGMQELVRRIGDDE
3chiA           PQPELVTYRRLRRVLADMPEQWERDIAVLVWGAVAE---TCINALLALLARDATIQPMHSLITTLHLRDE
3chhA           PQPELVTYRRLRRVLADMPEQWERDIAVLVWGAVAE---TCINALLALLARDATIQPMHSLITTLHLRDE
3chhB           PQPELVTYRRLRRV--LADMPEQWERDIAVL-VWGAVAETCINALLALLARDATIQPMHSLITTLHLRDE
1biqA           VTNEQIQKRAEGISSYYDELIEKKKLYLCLMSVNALEAIRYVSFACSFAFAERELMEGNAKIIRLIARDA
3dhzA           RWSEENENLQRKAKIIMSYYNGDDPLKKKVASTLLESFLFYSGFYLPMYLSSRAKLTNTADIIRLIIRDE
1biqB           LLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDA
3dhiB           EHERELWEKEPGWQGEKQLTAFDWGEAFVSLNLVVKPMIVESIFKPLQQQAWENNDTLLPLLIDSQLKDA
3dhgB           EHERELWEKEPGWQGLKQLTAFDWGEAFVSLNLVVKPMIVESIFKPLQQQAWENNDTLLPLLIDSQLKDA
3dhhB           EHERELWEKEPGWQGLKQLTAFDWGEAFVSLNLVVKPMIVESIFKPLQQQAWENNDTLLPLLIDSQLKDA
3dhgD           WRAYHSNEWAAIAAKHDIITGRDAISVAIMLTFSFETGFTNMQFLGLAADAAEAGDYTFANLISSIQTDE
4csmA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFIDLAFEMGPMQGLTAQDVKLYIRFIA
2aniA           TIHLNFGIDLINGIKEENPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGIL-GLRASMFIDYVQHIA
2bq1I           AVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEALYA----ETGWVNDVKAFLCYNA
2av8A           ALHLTGTQHMLNLLRSGADDPIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
3ee4A           RRHMAWGTFTCRRHVAADDANW-TVFETRMNELIPLALRLIEEGFALYGDQPPF-DLSKDDFLQYSTDKG
3chiA           TAHGSIVVEVVRELYARMNEQQRRALVRCLPIALEAFAEQDLSALLLELNAAGIEEIVGDLRLVRDFSGA
3chhA           TAHGSIVVEVVRELYARMNEQQRRALVRCLPIALEAFAEQD--------LSALLLELNAAGIRGAEEIVG
3chhB           TAHGSIVVEVVRELYARMNEQQRRALVRCLPIALEAFAEQDLSALLLELNAAGIRGEIVGDLLVRDFSGA
1biqA           ALHLTGTQHMLNLLRSGADDPEAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
3dhzA           SVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLGW----TEDVKRFLRYNA
1biqB           ALHLTGTQHMLNLLRSPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
3dhiB           ERHSRWSKALVKHA------LENPDNHAVIEGWIEKWRPLADRAAEAYLSM-------------------
3dhgB           ERHSRWSKALVKHA------LENPDNHAVIEGWIEKWRPLADRAAE------------------------
3dhhB           ERHSRWSKALVKHA------LENPDNHAVIEGWIEKWRPLADRAAE------------------------
3dhgD           SRHAQQGGPALQLLIENGKREEAQKKVDMAIWRAWRLFAVLTGPVMDYYTPLED----------------
4csmA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NRRLSQLGLEPIYDVDKNPLTWLDSMLNAVEHMNFFEGRSTEYxxxxxxxxxxxxxx
2aniA           DRRLERIGLKPIYHT-KNPFPWM----------------------------------
2bq1I           NKALMNLGYEALFPPE-MADVNPA-ILAALSPTVETEDEDWNF--------------
2av8A           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
3ee4A           MRRFGTISNARGRPVAE----------------------------------------
3chiA           RKMVEQLGLDDAVDDFPERPDW-----------------------------------
3chhA           DLRLVRDFSGARKMVQLGLDDAVDFDFPER---------------------------
3chhB           RKMVEQLGLDDAVD---FDFPERPD--------------------------------
1biqA           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
3dhzA           NKALNNLGYEGLFPTDTKVSPAILSSLS-----------------------------
1biqB           NIRMQAVGLDLPFQTRSNPIPWINTWLVS----------------------------
3dhiB           ---------------------------------------------------------
3dhgB           ---------------------------------------------------------
3dhhB           ---------------------------------------------------------
3dhgD           ---------------------------------------------------------
4csmA           ---------------------------------------------------------