[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ22048.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2c0cA.bssp"
#ERROR : Can't open dsspfile "2dm6A.bssp"
#ERROR : Can't open dsspfile "2dq4A.bssp"
#ERROR : Can't open dsspfile "1ee2A.bssp"
#ERROR : Can't open dsspfile "2b5wA.bssp"
#ERROR : Can't open dsspfile "3b70A.bssp"
#ERROR : Can't open dsspfile "1e3jA.bssp"
#ERROR : Can't open dsspfile "2eihA.bssp"
#ERROR : Can't open dsspfile "1axeA.bssp"
#ERROR : Can't open dsspfile "2cf5A.bssp"
#ERROR : Can't open dsspfile "1a71A.bssp"
#ERROR : Can't open dsspfile "2c0cB.bssp"
#ERROR : Can't open dsspfile "1axgA.bssp"
#ERROR : Can't open dsspfile "2cd9A.bssp"
#ERROR : Can't open dsspfile "2cd9B.bssp"
#ERROR : Can't open dsspfile "1e3lB.bssp"
#ERROR : Can't open dsspfile "2eerB.bssp"
#ERROR : Can't open dsspfile "2eerA.bssp"
#ERROR : Can't open dsspfile "3cosD.bssp"
#ERROR : Can't open dsspfile "1e3eB.bssp"
#ERROR : Can't open dsspfile "2b5vA.bssp"
#ERROR : Can't open dsspfile "2cdbA.bssp"
#ERROR : Can't open dsspfile "2dfvA.bssp"
#ERROR : Can't open dsspfile "2cdbC.bssp"
#ERROR : Can't open dsspfile "1e3lA.bssp"
#ERROR : Can't open dsspfile "3cosA.bssp"
#ERROR : Can't open dsspfile "2cdaB.bssp"
#ERROR : Can't open dsspfile "3b6zA.bssp"
#ERROR : Can't open dsspfile "2cdbB.bssp"
#ERROR : Can't open dsspfile "2d8aA.bssp"
#ERROR : Can't open dsspfile "1d1tA.bssp"
#ERROR : Can't open dsspfile "1d1sA.bssp"
#ERROR : Can't open dsspfile "2cdaA.bssp"
#ERROR : Can't open dsspfile "1e3eA.bssp"
#ERROR : Can't open dsspfile "1cdoA.bssp"
#ERROR : Can't open dsspfile "1bxzA.bssp"
#ERROR : Can't open dsspfile "2dphA.bssp"
#ERROR : Can't open dsspfile "2b83A.bssp"
#ERROR : Can't open dsspfile "1dlgA.bssp"
#ERROR : Can't open dsspfile "3eeqB.bssp"
#ERROR : Can't open dsspfile "2dg2A.bssp"
#ERROR : Can't open dsspfile "2ebjA.bssp"
#ERROR : Can't open dsspfile "2eguA.bssp"
#ERROR : Can't open dsspfile "3dwgB.bssp"
#ERROR : Can't open dsspfile "3dwgA.bssp"
#ERROR : Can't open dsspfile "3dkiA.bssp"
#ERROR : Can't open dsspfile "3d3jA.bssp"
#ERROR : Can't open dsspfile "3dwiA.bssp"
#ERROR : Can't open dsspfile "3dkiB.bssp"
#ERROR : Can't open dsspfile "3c85C.bssp"
#ERROR : Can't open dsspfile "3c85D.bssp"
#ERROR : Can't open dsspfile "3e90D.bssp"
#ERROR : Can't open dsspfile "2cnbB.bssp"
#ERROR : Can't open dsspfile "3e90B.bssp"
#ERROR : Can't open dsspfile "3dwiB.bssp"
#ERROR : Can't open dsspfile "1b8pA.bssp"
#ERROR : Can't open dsspfile "1ek6B.bssp"
#ERROR : Can't open dsspfile "3bywB.bssp"
#ERROR : Can't open dsspfile "2c29F.bssp"
#ERROR : Can't open dsspfile "2bhtB.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "2cnbA.bssp"
#ERROR : Can't open dsspfile "3e48B.bssp"
#ERROR : Can't open dsspfile "2c20A.bssp"
#ERROR : Can't open dsspfile "2c5eA.bssp"
#ERROR : Can't open dsspfile "3bywH.bssp"
#ERROR : Can't open dsspfile "2a35A.bssp"
#ERROR : Can't open dsspfile "2c29D.bssp"
#ERROR : Can't open dsspfile "3dxfA.bssp"
#ERROR : Can't open dsspfile "3e5mA.bssp"
#ERROR : Can't open dsspfile "3bywF.bssp"
#ERROR : Can't open dsspfile "1bwsA.bssp"
#ERROR : Can't open dsspfile "2b69A.bssp"
#ERROR : Can't open dsspfile "1a9zA.bssp"
#ERROR : Can't open dsspfile "3c3xA.bssp"
#ERROR : Can't open dsspfile "3bywD.bssp"
#ERROR : Can't open dsspfile "3e6vA.bssp"
#ERROR : Can't open dsspfile "2cnbC.bssp"
#ERROR : Can't open dsspfile "3e48A.bssp"
#ERROR : Can't open dsspfile "1arzB.bssp"
#ERROR : Can't open dsspfile "3d5tA.bssp"
#ERROR : Can't open dsspfile "1c9kA.bssp"
#ERROR : Can't open dsspfile "2bllA.bssp"
#ERROR : Can't open dsspfile "1e7qA.bssp"
#ERROR : Can't open dsspfile "2dfdA.bssp"
#ERROR : Can't open dsspfile "2a35B.bssp"
#ERROR : Can't open dsspfile "1e7rA.bssp"
#ERROR : Can't open dsspfile "3eheA.bssp"
#ERROR : Can't open dsspfile "2a92C.bssp"
#ERROR : Can't open dsspfile "2ekpA.bssp"
#ERROR : Can't open dsspfile "2aejB.bssp"
#ERROR : Can't open dsspfile "2axqA.bssp"
#ERROR : Can't open dsspfile "3c85B.bssp"
#ERROR : Can't open dsspfile "1arzC.bssp"
#ERROR : Can't open dsspfile "3d5tC.bssp"
#ERROR : Can't open dsspfile "3dbhC.bssp"
#ERROR : Can't open dsspfile "1ch6A.bssp"

## Summary of PDB Search
:333
    2e-37  22%  2c0cA  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    3e-36  21%  2dm6A  [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
    6e-36  18%  2dq4A  [x.x.x] L-THREONINE 3-DEHYDROGENASE
    2e-35  14%  1ee2A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    3e-35  16%  2b5wA  [x.x.x] GLUCOSE DEHYDROGENASE
    6e-35  20%  3b70A  [x.x.x] ENOYL REDUCTASE
    1e-34  16%  1e3jA  [b.35.1 - c.2.1] NADP(H)-DEPENDENT KETOSE REDUCTASE
    2e-34  23%  2eihA  [x.x.x] ALCOHOL DEHYDROGENASE
    2e-34  16%  1axeA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-33  21%  2cf5A  [x.x.x] CINNAMYL ALCOHOL DEHYDROGENASE
    3e-33  15%  1a71A  [b.35.1 - c.2.1] LIVER ALCOHOL DEHYDROGENASE
    7e-33  20%  2c0cB  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    8e-33  16%  1axgA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    8e-33  16%  2cd9A  [x.x.x] GLUCOSE DEHYDROGENASE
    1e-32  16%  2cd9B  [x.x.x] GLUCOSE DEHYDROGENASE
    1e-32  16%  1e3lB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    6e-32  20%  2eerB  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    8e-32  19%  2eerA  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    4e-31  17%  3cosD  [x.x.x] ALCOHOL DEHYDROGENASE 4
    4e-31  17%  1e3eB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    5e-31  15%  2b5vA  [x.x.x] GLUCOSE DEHYDROGENASE
    2e-30  16%  2cdbA  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    2e-30  16%  2dfvA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    3e-30  17%  2cdbC  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    5e-30  18%  1e3lA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    5e-30  18%  3cosA  [x.x.x] ALCOHOL DEHYDROGENASE 4
    6e-30  16%  2cdaB  [x.x.x] GLUCOSE DEHYDROGENASE
    8e-30  20%  3b6zA  [x.x.x] ENOYL REDUCTASE
    1e-29  16%  2cdbB  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    7e-29  16%  2d8aA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    9e-29  14%  1d1tA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    9e-29  14%  1d1sA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    2e-28  16%  2cdaA  [x.x.x] GLUCOSE DEHYDROGENASE
    3e-28  17%  1e3eA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    7e-28  19%  1cdoA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    3e-27  17%  1bxzA  [b.35.1 - c.2.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-25  18%  2dphA  [x.x.x] FORMALDEHYDE DISMUTASE
    3e-24  17%  2b83A  [x.x.x] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    9e-23  10%  1dlgA  [d.68.2] UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
    6e-22   9%  3eeqB  [x.x.x] PUTATIVE COBALAMIN BIOSYNTHESIS PROTEIN G
    1e-21  14%  2dg2A  [x.x.x] APOLIPOPROTEIN A-I BINDING PROTEIN
    2e-18  14%  2ebjA  [x.x.x] PYRROLIDONE CARBOXYL PEPTIDASE
    1e-11  18%  2eguA  [x.x.x] CYSTEINE SYNTHASE
    3e-11  17%  3dwgB  [x.x.x] CYSTEINE SYNTHASE B
    3e-11  13%  3dwgA  [x.x.x] CYSTEINE SYNTHASE B
    2e-10  14%  3dkiA  [x.x.x] CYSTEINE SYNTHASE B
    3e-10  10%  3d3jA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    1e-09  13%  3dwiA  [x.x.x] CYSTEINE SYNTHASE B
    1e-09  13%  3dkiB  [x.x.x] CYSTEINE SYNTHASE B
    4e-09  14%  3c85C  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    1e-08  13%  3c85D  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    2e-07  16%  3e90D  [x.x.x] NS3 PROTEASE
    4e-07  15%  2cnbB  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    4e-07  15%  3e90B  [x.x.x] NS3 PROTEASE
    2e-06  12%  3dwiB  [x.x.x] CYSTEINE SYNTHASE B
    4e-06  13%  1b8pA  [c.2.1 - d.162.1] PROTEIN (MALATE DEHYDROGENASE)
    5e-06  40%  1ek6B  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    2e-05  13%  3bywB  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    2e-05  24%  2c29F  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    3e-05  19%  2bhtB  [x.x.x] CYSTEINE SYNTHASE B
    3e-05  24%  1bxkA  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    3e-05  13%  2cnbA  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    3e-05  13%  3e48B  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    3e-05  39%  2c20A  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    3e-05  25%  2c5eA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    4e-05  17%  3bywH  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    5e-05  23%  2a35A  [x.x.x] HYPOTHETICAL PROTEIN PA4017
    5e-05  32%  2c29D  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    6e-05  19%  3dxfA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    7e-05  15%  3e5mA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    8e-05  13%  3bywF  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    9e-05  30%  1bwsA  [c.2.1] PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE
    9e-05  26%  2b69A  [x.x.x] UDP-GLUCURONATE DECARBOXYLASE 1
    1e-04  23%  1a9zA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    1e-04  22%  3c3xA  [x.x.x] EUGENOL SYNTHASE 1
    1e-04  18%  3bywD  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    2e-04  10%  3e6vA  [x.x.x] ARGINASE-1
    2e-04  30%  2cnbC  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    2e-04  22%  3e48A  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    2e-04  17%  1arzB  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    2e-04  22%  3d5tA  [x.x.x] MALATE DEHYDROGENASE
    2e-04  21%  1c9kA  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    3e-04  15%  2bllA  [x.x.x] PROTEIN YFBG
    3e-04  30%  1e7qA  [c.2.1] GDP-FUCOSE SYNTHETASE
    3e-04  35%  2dfdA  [x.x.x] MALATE DEHYDROGENASE
    3e-04  23%  2a35B  [x.x.x] HYPOTHETICAL PROTEIN PA4017
    4e-04  27%  1e7rA  [c.2.1] GDP-FUCOSE SYNTHETASE
    4e-04  35%  3eheA  [x.x.x] UDP-GLUCOSE 4-EPIMERASE (GALE-1)
    4e-04  17%  2a92C  [x.x.x] L-LACTATE DEHYDROGENASE
    4e-04  19%  2ekpA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    4e-04  12%  2aejB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    5e-04  13%  2axqA  [x.x.x] SACCHAROPINE DEHYDROGENASE
    6e-04  16%  3c85B  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    6e-04  18%  1arzC  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    6e-04  23%  3d5tC  [x.x.x] MALATE DEHYDROGENASE
    8e-04  14%  3dbhC  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    9e-04   5%  1ch6A  [x.x.x] GLUTAMATE DEHYDROGENASE
:333

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSDNFKALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFA
2c0cA           FQSMMQKLVVTRLSPNFREAVRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGI
2dm6A           FMVKAKSWTLKKHFQGKPTELKTVELPPLKNGEVLLEALFLSVDPYMRIASKRLKE----GAVMMGQQVA
2dq4A           -----RALAKLAPEEGL--TLVDRPVPEPGPGEILVRVEAASICGTDLHIWKWDAWARGRPPLVTGHEFS
1ee2A           ----CKAAVLWEQKKPF--SIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTLV--APLPVIAGHEAA
2b5wA           -----KAIAVKRGEDRP--VVIEKPRPEPESGEALVRTLRVGVCGTDHEVIAGGGFPEGEDHLVLGHEAV
3b70A           PPPQQTALTVNDHDEVT--VWNAAPCPMLPRDQVYVRVEAVAINPSDTKMRGQF----ATPWAFLGTDYA
1e3jA           --DNLSAVLY--KQNDL--RLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGRIADFKDPMVIGHEAS
2eihA           -----RAVVMRARGGPEVLEVADLPVPEPGPKEVRVRLKAAALNHLDVWVRKGVASPKLPLPHVLGADGS
1axeA           ----CKAAVLWEEKKPF--SIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLV--TPLPVIAGHEAA
2cf5A           ----TTGWAARDPSGIL--SPYTYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSN-YPMVPGHEVV
1a71A           ----CKAAVLWEEKKPF--SIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLV--TPLPVIAGHEAA
2c0cB           ----MQKLVVTRLSPNFREAVRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGI
1axgA           ----CKAAVLWEEKKPF--SIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSG--TLVTPLPVIAGHEAA
2cd9A           -----KAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGTDREIVNGKLT--LSKGKDFLVLGH
2cd9B           -----KAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGTDREIVN-GKLTLGKDFLVLGHEAI
1e3lB           ----CKAAIAWKTGSPL--CIEEIEVSPPKACEVRIQVIATCVCHTDINATDSPLTNLCGKLRNFKYPTI
2eerB           -----RAMRLVEIGKPL--KLEDIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGREDLGVKLPVTLGHEIA
2eerA           -----RAMRLVEIGKPL--KLEDIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGREDLGVKLPVTLGHEIA
3cosD           ----CKAAIAWEAGKPL--CIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFKISNLKSPAS
1e3eB           ----CKAAIAWKTGSPL--CIEEIEVSPPKACEVRIQVIATCVCPTDINATDP--KKKALFPVVLGHECA
2b5vA           -----KAIAV----KRGRPVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGGFPEGEDHLVLGHEAV
2cdbA           -----KAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGADREIVNGKLKG--KDFLVLGHEAI
2dfvA           -----KVAIKTKPGYGA--ELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWQSRIKPPQIGHEVA
2cdbC           -----KAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGADREIVNGKLK----DFLVLGHEAI
1e3lA           ----CKAAIAWKTGSPL--CIEEIEVSPPKACEVRIQVIATCVCHTDINATDP--KKKALFPVVLGHECA
3cosA           -----KAAIAWEAGKPL--CIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSPLTNLCGKISNLKSPAS
2cdaB           -----KAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGTDREIVNGKLG---KDFLVLGHEAI
3b6zA           PPPQQTALTVNDHDEVT--VWNAAPCPMLPRDQVYVRVEAVAINPSDTKMRGQFAT----PWAFLGTDYA
2cdbB           -----KAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGADREIVNGKLG---KDFLVLGHEAI
2d8aA           -----KVAIKTKPGYGA--ELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSIKPPQIGHEVA
1d1tA           ----CKAAVLWEQKQPF--SIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVS--KFPVIVGHEAT
1d1sA           ----CKAAVLWEQKQPF--SIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVS--KFPVIVGHEAT
2cdaA           -----KAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGTDREIVNGKLKG--KDFLVLGHEAI
1e3eA           ----CKAAIAWKTGSPL--CIEEIEVSPPKACEVRIQVIATCVCPTDINATDP--KKKALFPVVLGHECA
1cdoA           ----CKAAVAWEANKPL--VIEEIEVDVPHANEIRIKIIATGVCHTDLYHLFEGKH-KDGFPVVLGHEGA
1bxzA           -----KGFAML-SIGKV--GWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGER-HNMILGHEAV
2dphA           -----KSVVYHGTRDLRVETVKLEHNNRKLEHAVILKVVSTNICGSDQHIYRG--RFIVPKGHVLGHEIT
2b83A           -----KGFAML-GINKL--GWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDR-KNMILGHEAV
1dlgA           -----------------TMKLLTQLGTKVERGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQ
3eeqB           -----------------------------------------------SLIENLWRGICIISASEDAFSAG
2dg2A           ----------------------------------------------------------------------
2ebjA           ----------------------------------------------------------------------
2eguA           ----------------------------------------------------------------------
3dwgB           ----------------------------------------------------------------------
3dwgA           ----------------------------------------------------------------------
3dkiA           ----------------------------------------------------------------------
3d3jA           ----------------------------------------------------------------------
3dwiA           ----------------------------------------------------------------------
3dkiB           ----------------------------------------------------------------------
3c85C           ----------------------------------------------------------------------
3c85D           ----------------------------------------------------------------------
3e90D           ---------------------------RTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGN
2cnbB           ----------------------------------------------------------------------
3e90B           ----------------VVEPGKNVKNVRTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGN
3dwiB           ----------------------------------------------------------------------
1b8pA           ----------------------------------------------------------------------
1ek6B           ----------------------------------------------------------------------
3bywB           ----------------------------------------------------------------------
2c29F           ----------------------------------------------------------------------
2bhtB           ----------------------------------------------------------------------
1bxkA           ----------------------------------------------------------------------
2cnbA           ----------------------------------------------------------------------
3e48B           ----------------------------------------------------------------------
2c20A           ----------------------------------------------------------------------
2c5eA           ----------------------------------------------------------------------
3bywH           ----------------------------------------------------------------------
2a35A           ----------------------------------------------------------------------
2c29D           ----------------------------------------------------------------------
3dxfA           ----------------------------------------------------------------------
3e5mA           ----------------------------------------------------------------------
3bywF           ----------------------------------------------------------------------
1bwsA           ----------------------------------------------------------------------
2b69A           ----------------------------------------------------------------------
1a9zA           ----------------------------------------------------------------------
3c3xA           ----------------------------------------------------------------------
3bywD           ----------------------------------------------------------------------
3e6vA           ----------------------------------------------------------------------
2cnbC           ----------------------------------------------------------------------
3e48A           ----------------------------------------------------------------------
1arzB           ----------------------------------------------------------------------
3d5tA           ----------------------------------------------------------------------
1c9kA           ----------------------------------------------------------------------
2bllA           ----------------------------------------------------------------------
1e7qA           ----------------------------------------------------------------------
2dfdA           ----------------------------------------------------------------------
2a35B           ----------------------------------------------------------------------
1e7rA           ----------------------------------------------------------------------
3eheA           ----------------------------------------------------------------------
2a92C           ----------------------------------------------------------------------
2ekpA           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2axqA           ----------------------------------------------------------------------
3c85B           ----------------------------------------------------------------------
1arzC           ----------------------------------------------------------------------
3d5tC           ----------------------------------------------------------------------
3dbhC           ----------------------------------------------------------------------
1ch6A           -----VRGILRIIKPCN--HVLSLSFPIRRDDGSWEVIEGYRAQHSHQRTPCKGGIKALASLMTYKCAVV


                         .         .         *         .         .         .         .:140
query           GTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSF
2c0cA           GEVVALSASARYTVGQA------VAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKEL
2dm6A           RVVESKNSAFPAGSI-----VLAQSGWTTHFISDGKGLEKLLTEWPDKLPLSLALGTIGMPGLTAY---F
2dq4A           GVVEAPGVRRPQVGDHVSLETQILGVDRDGGFAEYVVVPAENAWVNPKDLPFEVAAILEPFGNAVHTVYA
1ee2A           GIVESEGVTTVRPGDKVIPLKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLVGCGFSTGYGSAV
2b5wA           GVVVDPNDTELEEGDIVVPTVRRPIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHA
3b70A           GTVVASDVTHIQVGDRVYQNEMCPRTPDQGAFSQYTVTRGRVWAKIPKGLSFEQAAALPAGISTAAMKLL
1e3jA           GTVVKKNVKHLKKGDRVAVETFCATPPDDGNLARYYVHAADFCHKLPDNVSLEEGALLEPLSVGVHACRR
2eihA           GVVVGPGVEGFAPGDEVVPRYQILGEHRHGTYAEYVVLPEANLAPKPKNLSFEEAAAIPLTFLTAW---Q
1axeA           GIVESEGVTTVRPGDKVIPLKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGY---G
2cf5A           GEVVESDVSKFTVGDLEQYCPYINGQPTQGGFAKATVVHQKFVVKIPEGMAVEQAAPLLCAGVTVYSPLS
1a71A           GIVESEGVTTVRPGDKVIRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYG---
2c0cB           GVALGLSASAR------YTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKLG
1axgA           GIVESEGVTTVRPGDKVIPLKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGY---G
2cd9A           EAIGVESYHGFSQGDLVMPFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEI
2cd9B           GVVEEHGFSQGDLVMPVNRFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEI
1e3lB           DQELMRTSRFTCKGRSIY------HFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSGY---G
2eerB           GRIEEDEVVGYSKGDLVAVNPRWLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTTYRAVR
2eerA           GRIEEDEVVGYSKGDLVADSPRWLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTTYRAVR
3cosD           DQQLMKTSRFTCKGKPVY------HFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTGYGAAI
1e3eB           GIVESPGVTNFKPGDQELMEDRTSHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAI
2b5vA           GVVVDPNDTELEEGDIVVPTVRRGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHA
2cdbA           GVVEEHGFSQGDLVMPVNRFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEI
2dfvA           GEVVEGKCYACRRGQYHCQNTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAVDTVLA
2cdbC           GVV-EESYHGFSQGDETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEI
1e3lA           GIVESVGPGKYPTIDQELMEDRTSRFTCKGSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAI
3cosA           DQQLMKTSRFTCKGKPV------YHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTGY---G
2cdaB           GVVEESGFSQGDLVMPVNRFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEI
3b6zA           GTVVASDVTHIQVGDRVYQNEMCPRTPDQGAFSQYTVTRGRVWAKIPKGLSFEQAAALPAGISTAGLAMK
2cdbB           GVVEESGFSQGDLVMPVNRFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKEEILE
2d8aA           GEVVEGPGVEGIEVGDYVSVETHIVCDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAVDTVLA
1d1tA           GIVESEGVTTVKPGDKVIPLKPVHHFLNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGY---G
1d1sA           GIVESEGVTTVKPGDKVIPLKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGY---G
2cdaA           GVVEEHGFSQGDLVMETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEI
1e3eA           GIVESVGPGKYPTIDQELMEDRTSHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSGY---G
1cdoA           GIVESPGVTEFQPGEKVIPLRKVLQFLGTSTFSQYTVVNQIAVAKIDPSAPLDTVCLLGCGVSTGF---G
1bxzA           GEVVESEVKDFKPGDRVVVEVQRGYHDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAE
2dphA           GEVVESDVELMDIGDLVSVPFGFDLKGWSGGQAEYVLVPYADYMLLKFGDKEQAMEKIKDLTLISDILPT
2b83A           GEVVESEVKDFKPGDRVIVPGWKFSNFKDGVFGEYFHVNDANLAILPKDMPLENAVMITDMMTTGF---H
1dlgA           GQVSL-------PGGSA--IGARPVIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIM
3eeqB           ETIKEKSFEIPVVHYRYKDAEI--ETIWKCYDAIVFVMALEGATRIVCKYAKEDPAIVCIDDKIN-----
2dg2A           ----------------------------YLSQEEAQAVDQELFNEYQFSVDQLELAGLSCATAIAKAYPP
2ebjA           ----------------ILVTGF----EPFGSLEHNPSQALLDLLPSEVDGKPLRKAVLPVDAEA------
2eguA           -----------------------IGDTPAVKLNRIVDEDSADVYLKLEFMNPGSSVKDRIALAMIEAAEK
3dwgB           -----DSLLQALGNTPLV-GLQRLS----PRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIE----
3dwgA           -----DSLLQALGNTPLV-GLQRLS----PRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEA
3dkiA           ------DSLLQALGNTPLVGLQRLS----PRWDDGRDGPHVRLWAKLEDRNPTGS--IDRPAVRMIEQAE
3d3jA           -----------------------------IVPSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRL
3dwiA           ----------ALGNTPLV-GLQRLS----PRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEA
3dkiB           ----------ALGNTPLVGLQR-----LSPRWDDGRDGPHVRLWAKLEDRNPTGSIDRPAVRMIEQAEAD
3c85C           ----------------------------------------------------------------------
3c85D           -----------------------------------------------------LGGRIGTGAYDELRAIS
3e90D           GVIMPSYISAIVQGKRMD----------------------------------------------------
2cnbB           ----------------------------------------------------------------------
3e90B           GVIMPSYISAIVQGKRMD----------------------------------------------------
3dwiB           --------------------LVGLQRLSPRWDDGRDGPHVRLWA-KLEDRNPTGSIKDRPAVRMIEQAEA
1b8pA           ----------------------------------------------------------------------
1ek6B           ----------------------------------------------------------------------
3bywB           -----------------------------------------------------LNSVSAPLSYTPISFDA
2c29F           ----------------------------------------------------------------------
2bhtB           -------------------------------------------------------------------DRA
1bxkA           ----------------------------------------------------------------------
2cnbA           ----------------------------------------------------------------------
3e48B           ----------------------------------------------------------------------
2c20A           ----------------------------------------------------------------------
2c5eA           ----------------------------------------------------------------------
3bywH           -----------------------------------------------------LNSVSAPLSYTPISFDA
2a35A           ----------------------------------------------------------------------
2c29D           ----------------------------------------------------------------------
3dxfA           ----------------------------------------------------------------------
3e5mA           ----------------------------------------------------------------------
3bywF           -----------------------------------------------------LNSVSAPLSYTPISFDA
1bwsA           ----------------------------------------------------------------------
2b69A           ----------------------------------------------------------------------
1a9zA           ----------------------------------------------------------------------
3c3xA           ----------------------------------------------------------------------
3bywD           -----------------------------------------------------LNSVSAPLSYTPISFDA
3e6vA           -------------------------------KEQECDVKGDLPFADIPNDSPFQIVK--NPRSVGKASEQ
2cnbC           ----------------------------------------------------------------------
3e48A           ----------------------------------------------------------------------
1arzB           ----------------------------------------------------------------------
3d5tA           ----------------------------------------------------------------------
1c9kA           ----------------------------------------------------------------------
2bllA           ----------------------------------------------------------------------
1e7qA           ----------------------------------------------------------------------
2dfdA           ----------------------------------------------------------------------
2a35B           ----------------------------------------------------------------------
1e7rA           ----------------------------------------------------------------------
3eheA           ----------------------------------------------------------------------
2a92C           ----------------------------------------------------------------------
2ekpA           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2axqA           ----------------------------------------------------------------------
3c85B           ----------------------------------------------------------------------
1arzC           ----------------------------------------------------------------------
3d5tC           ----------------------------------------------------------------------
3dbhC           ----------------------------------------------------------------------
1ch6A           DVPFGKAGVKINPKNYTDEDLEK-----------------------------------------------


                         +         .         .         .         .         *         .:210
query           AIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDK
2c0cA           G-----GLSEGKKV---LVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINTEPVGT
2dm6A           GLLEVCGVKGGETV---LVSAAAGAVGSVVGQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNE
2dq4A           GSG---------VSGKSVLITGAGPIGLMAAMVVRASGAGPILVSDPNPYRLAFARPYADRLVNPLEEDL
1ee2A           KVAKVTQG------STCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKK
2b5wA           YASRSAFDWDPSS---AFVLGN-GSLGLLTLAMLKVDDKGYENLYCLDPTIDIIEELDATYVDSRQTPVE
3b70A           GLPLPSPSADHSKPVYVLVYGGSTATATVTMQML-RLSGYIPIATCSPHNFDLAKSRGAEEVFDAPNLAQ
1e3jA           AGVQLG---------TTVLVIGAGPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGADVTLVVDPAKE
2eihA           MVVDKLGVRPGD---DVLVMAAGSGVSVAAIQIAKLFGARVIATAGSEDKLRRAKALGADETVNYTHPDE
1axeA           SAVKVAKVTQGSTC---AVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKK
2cf5A           HFGLKQPGLRGGIL-------GLGGVGHMGVKIAKAMGHHVTVISSNKKREEALQDLGADDYVIGSDQAK
1a71A           ---SAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKK
2c0cB           GLSEG---------KKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPV
1axgA           SAVKVAKV---TQGSTCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKK
2cd9A           RVPVWTCDDGTLNCRKVLVVGT-GPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNG
2cd9B           LEVQKRVPVWGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNK
1e3lB           AAINTAKVTPGSTC---AVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDK
2eerB           KASLDPS-------KTLVVIGAGGGLGTMAIQIAKAVSGATIIGVVREEALEAAKRAGADYVINASSQDE
2eerA           ----KASLDPSKTLV---VIGAGGGLGTMAIQIAKAVSGATIIGVDVREALEAAKRAGADYVINASSQDP
3cosD           NNAKVTPG------STCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKALGATDCLNPRDLHK
1e3eB           NTAK------VTPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDK
2b5vA           YASRSA----FDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYRPDPTIDIIEELDATYVDSRQTPVE
2cdbA           LEVQKRVPVWGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNK
2dfvA           GPIS----------GKSVLITGAGPLGLLGIAVAKASGAYPVIVSPSDFRRELAKKVGADYVINEEDVVK
2cdbC           KRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNG
1e3lA           NTAKV------TPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDK
3cosA           AAINNAKVTPG---STCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKALGATDCLNPRDLHK
2cdaB           KRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNK
3b6zA           LLGLPLPSPSADQPVYVLVYGGSTATATVTMQML-RLSGYIPIATCSPHNFDLAKSRGAEEVFDAPNLAQ
2cdbB           VQKRVPVWTCDDGTLRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNG
2d8aA           GPIS----------GKSVLITGAGPLGLLGIAVAKASGYPVIVSEPSDFRRELAKKVGADYVINPFEEDE
1d1tA           AAVKTGKVKPGSTC----VVFGLGGVGSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTK
1d1sA           AAVKTGKVKPGSTC----VVFGLGGVGSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTK
2cdaA           KRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNG
1e3eA           AAINTAKVTPGST---CAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDK
1cdoA           AAVNTAKVEPGSTC----AVFGLGAVGLAAVMGCHSAGKRIIAVDLNPDKFEKAKVFGATDFVNPNDHSE
1bxzA           LADIELG--------ATVAVLGIGPVGLMAVAGAKLRGARIIAVGSRPVCVDAAKYYGATDIVNYKDGPI
2dphA           GFHGCV--SAGVKPGSHVYIAGAGPVGRCAAAGARLLGAAVIVGDQNPERLKLLSDAGFETIDLRNSAPL
2b83A           GAE-LADIQMGSSV--VVI-----GIGAVGLMAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHQ
1dlgA           SAATL------AEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVRLGGGVYRVLPDRIET
3eeqB           --------------YVIPLLGGHWGANDIARELSVILNSTPIITKLSIERIANILIAKIINPENIVKINA
2dg2A           TSSKSPP--------TVLVICGPGNNGGDGLVHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKDIPFLG-
2ebjA           LGEALEDLHREGPKAVLHLGLAEDRPVLTLERLVNLLDFPRPDNRGRVLEDLPIVPGGPLALPARFPVKP
2eguA           AGKLKP--------GDTIVEPTSGNTGIGLAMVAAAKGYKAVLDTMSLERRNLLRAYGAELVLTPGAQG-
3dwgB           QAEADGLLRPGATI----LEPTSGNTGISLAMAARLKGYRLICVMPSVERRQLLELYGAQIIFSAANTA-
3dwgA           DGLLRP--------GATILEPTSGNTGISLAMAARLKGYRLICVNTSVERRQLLELYGAQIIFSAAEGGS
3dkiA           ADG-------LLRPGATILEPTSGNTGISLAMAARLKGYRLICVNTSVERRQLLELYGAQIIFSAAEGGS
3d3jA           EMTGVTLLGQRPTVALLCGPHVKGAQGISCGRHLANHDVQVILLPNFVKMLESITNELSLFSKTQGQQVS
3dwiA           DGLLRP--------GATILEPTSGNTGISLAMAARLKGYRLICVNTSVERRQLLELYGAQIIFSAGGSNT
3dkiB           GLL--------RPGATILEPTSG-NTGISLAMAARLKGYRLICVNTSVERRQLLELYGAQIIFS------
3c85C           --------------HAQVLILG-GRIGTGAYDELRARYGKISLGIIREEAAQQHRSEGRNVISGDATDPD
3c85D           LGIEINVI---SGDVKLVLLAPHHQGNQTALEQLQRRNYKIAAIAEYPDQLEGLLESGVDAAFN------
3e90D           ----------------------------------------------------------------------
2cnbB           --------------MRVLVCGGAGYIGSHFVRALLRDTNHSVVIVGTHGKSDHVETRENVARKLQQSDGP
3e90B           ----------------------------------------------------------------------
3dwiB           DGLLRP--------GATILEPTSGNTGISLAMAARLKGYRLICVNTSVERRQLLELYGAQIIFSAASNTT
1b8pA           --------------MRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQGVMMEID
1ek6B           --------------EKVLVTGGAGYIGSHTVLELLEAGYLPVVI--------------------------
3bywB           KIPVASVDKLRKDQDLILGTLPANSEDAGARGLFVRANDDGLQITSHGELVRELAQLPADATIAISATDE
2c29F           --------------ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLW
2bhtB           ALSMIVEAEKRGRIKDVLIEATSGNTGIALAMIAALKGYRMK-LLMPDNRRAAMRAYGAELIEGARDEMG
1bxkA           --------------RKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEK
2cnbA           --------------MRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHVARKLQQSDGPKP
3e48B           -----------------ILTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPDDWRGKVSVRQLDYFNQ
2c20A           ----------------ILICGGAGYIGSHAVKKLVDEGLSVVVV--------------------------
2c5eA           --------------LKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTE----------------
3bywH           KIPVASVDKLRKDQDLILGTLPANSEDAGARGLFVRANDDGLQITSHGELVRELAQLPADATIAISATED
2a35A           --------------KRVLLAGATGLTGEHLLDRILSEPTLAKVI--------------------------
2c29D           --------------ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLW
3dxfA           --------------KLVVVFGGTGAQGGSVARTLLEDGTFKVRVVTANPRKKAAKELRLQGAEVVQGDQD
3e5mA           --------------KLVVVFGGTGAQGGSVARTLLEDGTFKVRVVTRNPRKKAAKELRLQGAEVVQGDQD
3bywF           KIPVASVDKLRKDQDLILGTLPANSEDAGARGLFVRANDDGLQITSHGELVRELAQLPADATIAISATDE
1bwsA           --------------QRVFIAGHRGMVGSAIRRQLEQRGDVE-----------------------------
2b69A           --------------KRILITGGAGFVGSHLTDKLDGHEVTVVDNFFTGRKRNV-----------------
1a9zA           ----------------VLVTGGSGYIGSHTCVQLLQNGHDVIILNSKRSVLPVIERLGGKHPTFVEGDIR
3c3xA           --------------SKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTL----------------
3bywD           KIPVASVDKLRKDQDLILGTLPANSEDAGARGLFVRANDDGLQITSHGELVRELAQLPADATIAISATDE
3e6vA           LAGKVAEVKKNGRI--SLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSF
2cnbC           --------------MRVLVCGGAGYIGSHFVRALLRDTNHSVVI--------------------------
3e48A           -----------------ILTGATGHLGTHITNQAIANHIDHFHI--------------------------
1arzB           --------------IRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELA--------
3d5tA           ------------PAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQ--------------------------
1c9kA           ----------------ILVTGGARSGKSRHAEALIGDAPQVLYIATSQI---------------------
2bllA           ----------------VLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---------------
1e7qA           --------------QRVFIAGHRGMVGSAIRRQLEQRGDVE-----------------------------
2dfdA           --------------AKVAVLGASGGIGQPLSLLLKNSPLV------------------------------
2a35B           --------------KRVLLAGATGLTGEHLLDRILSEPTLAKVI--------------------------
1e7rA           --------------QRVFIAGHRGMVGSAIRRQLEQRGDVELVL--------------------------
3eheA           ----------------IVVTGGAGFIGSHVVDKLSESNE-------------------------------
2a92C           --------------KPKIVLVGSGMIGGVMATLIVQKNLGDVVM--------------------------
2ekpA           --------------RKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPK
2aejB           --------------RHVVICGW-SESTLECLRELRGSEVFVLAED--ENVRKKVLRSGANFVHGDPTRVS
2axqA           --------------KNVLLLGS-GFVAQPVIDTLAANDDINVTVACRTLAAQALAKPSGSKAISLDVTDD
3c85B           --------------HAQVLILG-GRIGTGAYDELARYGKISLGIEIREEAAQQHRSEGRNVISGDATDPD
1arzC           -----------DANIRVAIAGAGGRMGRQLIQAALALEG-------------------------------
3d5tC           --------------KRVAVTGAAGQIAYSLLFRIANGDLLGKDQ--------------------------
3dbhC           ---DRQLRLWGDHGAHVCLINA-TATGTEILKNLVLPGIGSFTIQVSGEDAGNNFFLQRSSIGKNRAEAA
1ch6A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DARPLDKGLWDGVVDTVGGKILANALAQTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASI
2c0cA           VLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKVQGFFLNHYLSKYQAA
2dm6A           ALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNRMDQPESIIYKQLRIEGFIVYRWQG
2dq4A           LERVTGSGVEVLLEFSGNEAAIHQGLMALIPGGEARILGIPSDPIRFDLAGELVMRGITAFGIAGRRLWQ
1ee2A           PLTEMSNGGVDFSFEVIGRLDTMVASCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKS
2b5wA           DVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWA-FEVDAGAFHREMVLHNKALVGSVN
3b70A           TIRTYTKNNLRYALDCITNVTTFCFAAIGRAGGHYVSLNPFPETRKMVTTDWTLGPTIFGEGSPGSEEER
1e3jA           EIRSAIGDLPNVTIDCSGNEKCITGINITRTGGTL-MLVGMGSQMVTVPLVNACAREIDIKSVFRYCNDY
2eihA           VRRLTGGKGADKVVDHTGALYFEGVIKATANGGRIAIAGASSGYEGTLPFAHVFYRQLSILG------ST
1axeA           PIQEMSNGGVDFSFEVIGRLDTVTALSCCQEAYGVSVIVGVPPDQNLSMNPMLLLSGRTWKGAIFGGFKS
2cf5A           MSE--LADSLDYVIDTVPVHHALEPYLSLLKLDGKLILMGVINNPLQFLTPLLMLGRKVITG----SFIG
1a71A           PIQEVLTGGVDFSFEVIGRLMVTALSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKS
2c0cB           GTKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKFLNHYL
1axgA           PIQEVLTGGVDFSFEVIGRLDTMVTLSCCQEAYGVSVIVVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKS
2cd9A           YDKLKGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLVHTNKTIIGLVNGQKPH
2cd9B           LKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIGLVNGQKPH
1e3lB           PVTELTAGGVDYSLDCAGTAQTKAAVDCTVLGWGSCTVVGAKVDE-MTIPTVDVILGRSINGTFFGGWKS
2eerB           IRRITQGKGADAVIDLNNSKTLSIYPYVLAKQGKYVMVGLFGAD-LKYHAPLITLNEVQFIG------SL
2eerA           VSEIRRKGADAVIDLNNSEKTLSIYPYVLAKQGKYVMVGLFGAD-LKYHAPLITLNEVQFIG------SL
3cosD           PIIELTKGGVDFALDCAGGSETMKAALDCTTAGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKS
1e3eB           PVTELTAGGVDYSLDCAGAQTLKAAVDCTVLGWGSCTVVGAKVDE-MTIPTVDVILGRSINGTFFGGWKS
2b5vA           DVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVD-AGAFHREMVLHNKALVGSVN
2cdbA           LKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIGLVNGQKPH
2dfvA           EVDITDGNGVDVFLEFSGAKALEQGLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKALTIYGITGRHLWE
2cdbC           YDKLKDSVGKFDVITGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIGLVNGQKPH
1e3lA           PVTELTAGGVDYSLDCAGAQTLKAAVDCTVLGWSCTVVGAKVDEMTIPTVDVILGRSINGTFFGGWKSVD
3cosA           PIIELTKGGVDFALDCAGGSETKAALDCTTAGWGSCTFIVAAGSKGLTVFPEELIIGRTINGTFFGGW--
2cdaB           LKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIGLVNGQKPH
3b6zA           TIRTYTKNNLRYALDCITESTTFCFAAIGRAGGHYVSLNPFPRKMVTTDWTLGPTIFGEGSTWPAPYGRP
2cdbB           YDDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIGLVNGQKPH
2d8aA           VDITDGNGVDVFLEFSGAPKALEQGLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKALTIYGITGRHLWE
1d1tA           PISEVLSEMTGNNVGYTLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGL--
1d1sA           PLSEMTGNNVGYTFEVIGHTMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGL--
2cdaA           YDKLKDSVGKFDVITGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIGLVNGQKPH
1e3eA           PVTELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTVVGAKVDEMTIPTVDVILGRSINGTFFGGWKS
1cdoA           PISQVLSGVDFSLECVGNVGVMRNALESCLKGWGVSVLVGWTDLHDVATRPIQLIAGRTWKGSMFGGFKG
1bxzA           ESQIMNLTEGKGVDAAIGGNIMATAVKIVKPGGTIANVNYFGEG-EVLPVPRLEWGCGMAHKTIKGGLCP
2dphA           RDQIDQILGKDCGVDAVGFGALNSLFDVVRAGGAIGIPGIYVGSDPDPVNKDAGSGRLHLDFGKMWTKSI
2b83A           VMKLTNGKGVDRVIMAGGSETLSQAVSMVKPGGIISNINYHGSGLIPRVEWGCGMAHKTIKGGLCPGGRL
1dlgA           GLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWIS---LDMHGKRPKAVTVRT--------
3eeqB           AL--LRDESICIDGINVNFPENIKVCSYIISLRDKEYKDKIVVWLKPLKISIGIGSKKDVKMEEIRDGIY
2dg2A           EPPEPVDELYELVVDAIFGFSFKGDVRESGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSAT
2ebjA           VLARWREAGIPGRPSLSAGSYLCNSLYRLPEEVPVGFLHLPPDETL------------------------
2eguA           -----MRGAIAKAEELVREHG---YFMPTTGKEIVEQMGDQLD---------------------------
3dwgB           ----------------------------------------------------------------------
3dwgA           NTA--VATAKELAATNPSWVMLYQYGNPANTDSHYCGTG-------------------------------
3dkiA           NTA--VATAKELAATNPSWVMLYQYGNPANTDSHYCGTG-------------------------------
3d3jA           SLKDLPTSPVDLVINCLDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHIDAKSLALGLPLPLGEH
3dwiA           AVELAATNPSWVMLYQYGNPANTDSHYCGTGPELLADLPEIT----------------------------
3dkiB           ----------------------------------------------------------------------
3c85C           FWERILDTGHVKLVLLAPHQGNQTALEQLQRRNYKGQIAAIAEYPDQLEGL-------------------
3c85D           ----------------------------------------------------------------------
3e90D           ----------------------------------------------------------------------
2cnbB           KPPWADRYAALEVGDVRNEDFLNGVFTRHGPIDAVVHMCAFLAVG-------------------------
3e90B           ----------------------------------------------------------------------
3dwiB           AKELAATNPSWVMLYQYGNPANTDSHYCGTGPELLADLPEITH---------------------------
1b8pA           DCAFPLLAGMTAHADPMDADVALLVGARPRGPGM------------------------------------
1ek6B           ----------------------------------------------------------------------
3bywB           TTA---GIEGDDSTTETVERDVRPIIGIYTE---------------------------------------
2c29F           KADLADEGSFDEAIKGC-------TGVFHVATPMDFESKDPENEVIKPTIE-------------------
2bhtB           EGKLLDQFNNPDNPKAHYTTTGPEIWQQTGGRHFVSSMGTTGTITGVSEFMREQSKPVTIVGLQPEEGSS
1bxkA           VD--------------------------------------------------------------------
2cnbA           PWADRYAALEVGDVRNEDFLNGVFTRHGPIDAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLL------
3e48B           ES--------------------------------------------------------------------
2c20A           ----------------------------------------------------------------------
2c5eA           ----------------------------------------------------------------------
3bywH           ETTAGIEETVERDVRPIIG-IYSNAAADLLNAGLNA----------------------------------
2a35A           ----------------------------------------------------------------------
2c29D           KADLADEGSFDEAIK-------------------------------------------------------
3dxfA           DQVIMELALNYATF--------------------------------------------------------
3e5mA           DQVIMELALNGAYATFIVTNAWESCSQEQEVKQGKLLADLARRLGLHYVVYSGLENIKKLTA--------
3bywF           TTA---GIEGDDSTTETVERDVRPIIGIYTE---------------------------------------
1bwsA           ----------------------------------------------------------------------
2b69A           ----------------------------------------------------------------------
1a9zA           NEALMTETVIHFAGLKAVGESVQKPLEYYDNN--------------------------------------
3c3xA           ----------------------------------------------------------------------
3bywD           TTAGIEGETVERDVRPIIG-IYSNAAADLLNAGLNA----------------------------------
3e6vA           LLKELKGPGFSWVTPCISAKDIVYIGLRDVN---PGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYL
2cnbC           ----------------------------------------------------------------------
3e48A           ----------------------------------------------------------------------
1arzB           ----------------------------------------------------------------------
3d5tA           ----------------------------------------------------------------------
1c9kA           ----------------------------------------------------------------------
2bllA           ----------------------------------------------------------------------
1e7qA           ----------------------------------------------------------------------
2dfdA           ----------------------------------------------------------------------
2a35B           ----------------------------------------------------------------------
1e7rA           ----------------------------------------------------------------------
3eheA           ----------------------------------------------------------------------
2a92C           ----------------------------------------------------------------------
2ekpA           GL-------VKRALEALGGHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAF----------------
2aejB           DLEKANVRGARAVIVDLESIHCILGIRKIDESVRIIAEAE------------------------------
2axqA           SALDKVLADNDVVISLIPYTFHPNVVKSAIRTKTDVVTSSYISP-ALRELEPEIVKAGITVMNEIGLDPG
3c85B           FWERILDTGHVKLVLLAPHQGNQTALEQLQRRNYKG----------------------------------
1arzC           ----------------------------------------------------------------------
3d5tC           ----------------------------------------------------------------------
3dbhC           MEFLQELNSDVSGS--------------------------------------------------------
1ch6A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KRREFVWNEVKSLIDFEQLEKSIKTVSLEDLIDIYPKMLKGETSGRYIVDLNK
2c0cA           MSEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVEL--
2dm6A           DVREKALRDLMKWVLEGKIQYHEVTKGFENMPAAFIEMLNGANLGKAVV----
2dq4A           TWMQGTALVYSGRVDLSPLL--THRLPLSRYREAFGLLASGQA-VKVILDPK-
1ee2A           KDS---VPKLVADFMAKKFALDTHVLPFEKINEGFDLLRSGKSIRTILT----
2b5wA           SHVEHFEAATVTFTKLPKLEDLVGVHPLSEFEAAF---DDDDTTIKTAIEFST
3b70A           QFGEDLWRIAGQLVEDGRLVHHPVQGGFDHIKQGMELVRKGELSGEKLVV---
1e3jA           PIALEMVASGR--CNVKQLV--THSFKLEQTVDAFEAARKKADNTIKVM----
2eihA           MASKSRLFPILRFVEEGKLKPVVQVLPLEAAAEGHRLLEERRVFGKVVLQV--
1axeA           KDSADFMAALDPLIT--------HVLPFEKINEGFDLLRSGESIRTILT----
2cf5A           SMKE--TEEMLEFCKEKGLSSIIEVVKMDYVNTAFERLEKNDVRYRFVVDVEG
1a71A           KDS---VPKLVADFMAKKFALDTHVLPFEKINEGFDLLRSGESIRTILT----
2c0cB           SKYQAAMSHLLEMCDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELP-
1axgA           KDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTILT----
2cd9A           FQQAVVHLASWKTLYPKAAKMLIKTVSINDEKELL-KVLKEHGEIKIRIL---
2cd9B           FQQAVVHLASWKTLYPKAAKMLIKTVSINDEKELL-KVLKEHGEIKIRIL---
1e3lB           VDS---VPNLVSDYKNKKFDLDTHALPFESINDAIDLMKEGKSIRTILT----
2eerB           VGNQSDFLGIMSLAEAGKVKPMVKTMKLEEANEAIDNLENFKAVGRQVL----
2eerA           VGNQSDFLGIMSLAEAGKVKPMVKTMKLEEANEAIDNLENFKAVGRQVL----
3cosD           VDS---IPKLVTDYKNKKFNLDTHTLPFDKISEAFDLMNQGKSIRTILI----
1e3eB           VDS---VPNLVSDYKNKKFDLDTHALPFESINDAIDLMKEGKSIRTILT----
2b5vA           SHVEHFEAATVTFTKLPKWFLEDGVHPLSEFEAAF---DDDDTTIKTAIEFST
2cdbA           FQQAVVHLASWKTLYPKAAKMLIKTVSINDEKELL-KVLKEHGEIKIRIL---
2dfvA           TWYTVSRLLQSGKLNLDPI-ITHKYKGFDKYEEAF-ELRAGKTGKVVFL----
2cdbC           FQQAVVHLASWKTLYPKAAKMLIKTVSINDEKELL-KVLKEHGEIKIRIL---
1e3lA           SVPNLVSDYKNKKFDLDLLV--THALPFESINDAIDLMKEGKSIRTILT----
3cosA           -KSVDSIPKLVTDYKFNLDALVTHTLPFDKISEAFDLMNQGKSIRTILI----
2cdaB           FQQAVVHLASWKTLYPKAAKMLIKTVSINDEKELL-KVLKEHGEIKIRIL---
3b6zA           GSEEERQFGEDLWRIAGQLVEDVVQGGFDHIKQGMELVRKGELSGEKLV----
2cdbB           FQQAVVHLASWKTLYPKAAKMLIKTVSINDEKELL-KVLKEHGEIKIRIL---
2d8aA           TWYTVSRLLQSGKLNLDPI-ITHKYKGFDKYEEAF-ELRAGKT-GKVVF----
1d1tA           -KSRDDVPKLVTEFKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLT----
1d1sA           -KSRDDVPKLVTEFKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLT----
2cdaA           FQQAVVHLASWKTLYPKAAKMLIKTVSINDEKELL-KVLKEHGEIKIRIL---
1e3eA           VDS---VPNLVSDYKNKDLDLLVHALPFESINDAIDLMKEGKSIRTILT----
1cdoA           KDG---VPKMVKAYLDKKVKLDTHRMPLESVNDAIDLMKHGKC-IRTVLSL--
1bxzA           GGRLR-MERLIDLVFYKRVDVTHVFRGFDNIEKAFMLMKDKPKDIKPVVIL--
2dphA           RIMTGMANYNRHLTEAYLSKVMNEVITLDQAPDGYAKFDKGSP-AKFVIDPHG
2b83A           RAEMLRDMVVYNRVDLSKL-VTHVYHGFDHIEEALLLMKDKPKLIKAVVIL--
1dlgA           -----------------------------------------------------
3eeqB           KVLERLN----------------------------------------------
2dg2A           HFTGRYHYLGGRFVP----PALEKKYQLNLPSY--------------------
2ebjA           -----------------------------------------------------
2eguA           -----------------------------------------------------
3dwgB           -----------------------------------------------------
3dwgA           -----------------------------------------------------
3dkiA           -----------------------------------------------------
3d3jA           -----------------------------------------------------
3dwiA           -----------------------------------------------------
3dkiB           -----------------------------------------------------
3c85C           -----------------------------------------------------
3c85D           -----------------------------------------------------
3e90D           -----------------------------------------------------
2cnbB           -----------------------------------------------------
3e90B           -----------------------------------------------------
3dwiB           -----------------------------------------------------
1b8pA           -----------------------------------------------------
1ek6B           -----------------------------------------------------
3bywB           -----------------------------------------------------
2c29F           -----------------------------------------------------
2bhtB           IPGIRRW----------------------------------------------
1bxkA           -----------------------------------------------------
2cnbA           -----------------------------------------------------
3e48B           -----------------------------------------------------
2c20A           -----------------------------------------------------
2c5eA           -----------------------------------------------------
3bywH           -----------------------------------------------------
2a35A           -----------------------------------------------------
2c29D           -----------------------------------------------------
3dxfA           -----------------------------------------------------
3e5mA           -----------------------------------------------------
3bywF           -----------------------------------------------------
1bwsA           -----------------------------------------------------
2b69A           -----------------------------------------------------
1a9zA           -----------------------------------------------------
3c3xA           -----------------------------------------------------
3bywD           -----------------------------------------------------
3e6vA           LGR--------------------------------------------------
2cnbC           -----------------------------------------------------
3e48A           -----------------------------------------------------
1arzB           -----------------------------------------------------
3d5tA           -----------------------------------------------------
1c9kA           -----------------------------------------------------
2bllA           -----------------------------------------------------
1e7qA           -----------------------------------------------------
2dfdA           -----------------------------------------------------
2a35B           -----------------------------------------------------
1e7rA           -----------------------------------------------------
3eheA           -----------------------------------------------------
2a92C           -----------------------------------------------------
2ekpA           -----------------------------------------------------
2aejB           -----------------------------------------------------
2axqA           IDHLYAVKTID------------------------------------------
3c85B           -----------------------------------------------------
1arzC           -----------------------------------------------------
3d5tC           -----------------------------------------------------
3dbhC           -----------------------------------------------------
1ch6A           -----------------------------------------------------