[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ22059.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1d4aA.bssp"
#ERROR : Can't open dsspfile "2b3dB.bssp"
#ERROR : Can't open dsspfile "2b3dA.bssp"
#ERROR : Can't open dsspfile "2d5iA.bssp"
#ERROR : Can't open dsspfile "2amjC.bssp"
#ERROR : Can't open dsspfile "3brcB.bssp"
#ERROR : Can't open dsspfile "2amjA.bssp"
#ERROR : Can't open dsspfile "1dxqA.bssp"
#ERROR : Can't open dsspfile "2amjD.bssp"
#ERROR : Can't open dsspfile "3b6iA.bssp"
#ERROR : Can't open dsspfile "3b6mB.bssp"
#ERROR : Can't open dsspfile "3b6mA.bssp"
#ERROR : Can't open dsspfile "3brcA.bssp"
#ERROR : Can't open dsspfile "3edoA.bssp"
#ERROR : Can't open dsspfile "2a5lB.bssp"
#ERROR : Can't open dsspfile "3edoB.bssp"
#ERROR : Can't open dsspfile "2amjB.bssp"
#ERROR : Can't open dsspfile "2a5lA.bssp"
#ERROR : Can't open dsspfile "2arkA.bssp"
#ERROR : Can't open dsspfile "2arkB.bssp"
#ERROR : Can't open dsspfile "3d7nA.bssp"
#ERROR : Can't open dsspfile "1aktA.bssp"

## Summary of PDB Search
:189
    1e-32  25%  1d4aA  [c.23.5] QUINONE REDUCTASE
    2e-18  15%  2b3dB  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    2e-17  17%  2b3dA  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    1e-16  16%  2d5iA  [x.x.x] AZO REDUCTASE
    2e-16  15%  2amjC  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    2e-15   8%  3brcB  [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION
    3e-14  17%  2amjA  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    5e-14  20%  1dxqA  [c.23.5] QUINONE REDUCTASE
    8e-14  17%  2amjD  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    1e-13  17%  3b6iA  [x.x.x] FLAVOPROTEIN WRBA
    6e-13  15%  3b6mB  [x.x.x] FLAVOPROTEIN WRBA
    8e-13  20%  3b6mA  [x.x.x] FLAVOPROTEIN WRBA
    2e-11   8%  3brcA  [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION
    3e-11  15%  3edoA  [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
    3e-11  19%  2a5lB  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    2e-10  14%  3edoB  [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
    9e-10  14%  2amjB  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    3e-09  19%  2a5lA  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    4e-04  14%  2arkA  [x.x.x] FLAVODOXIN
    4e-04  18%  2arkB  [x.x.x] FLAVODOXIN
    8e-04  14%  3d7nA  [x.x.x] FLAVODOXIN, WRBA-LIKE PROTEIN
    8e-04  18%  1aktA  [x.x.x] FLAVODOXIN
:189

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFAGEQAGEDVLDHRRRIEKCDI
1d4aA           -RRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITPDIVAEQKKLEAADL
2b3dB           -SNILIINGAKKFAHSNGQLNDTLTEVADG-TLRDLGHDVRIVRADSD-------YDVKAEVQNFLWADV
2b3dA           -SNILIINGAKKFAHSNGQLNDTLTEVADGTLR-DLGHDVRIVRADSDY-------DVKAEVQNFLWADV
2d5iA           --KVLVLKSSILGYSQSNQLSDYFVEQWREKADEITVRDLAANPIPVLDGELVGALLSDELIAELKAHDV
2amjC           --NILIINGA---KQLNDTLTEVADGTLRDLGHDVRIVRADSDY------------DVKAEVQNFLWADV
3brcB           -------------DLIGKAYLESAEDRRR--GDRSEEVEAIRKYIRSANAEKVDAINDVLRSFNLREAEH
2amjA           -SNILIINGAKG--QLNDTLTEVADGTLRDLGHDVRIVRADSDY------------DVKAEVQNFLWADV
1dxqA           ARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIIELKDSKPDIVAEHKKLEAADL
2amjD           SSNILIINGAKNDTLTEVADG-----TLRDLGHDVRIVRADSD------------YDVKAEVQNFLWADV
3b6iA           --KVLVLYYSMYGHIETMA--RAVAEGAKVDGAEVVVKRVPETMPPQLFEKAGGKTAPVATPQELADYDA
3b6mB           --KVLVLYYSMYGHIETMA-RAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTAPVATPQELADYDA
3b6mA           --KVLVLYYSMYGHIETMA--RAVAEGASKVGAEVVVKRVPETMPPQLFAGGKTQTAPVATPQELADYDA
3brcA           ------------EDLIGKAYLESAEDRRR--GDRSEEVEAIRKYIRSANAEKVDAINDVLRSFNLREAEH
3edoA           -KKTLILYYSWS--GETKKAEKINSEIKDSELKEVKVSEGTFDADYKTSQGNKDFPEIQLDNIDYNNYDL
2a5lB           -PYILVLYYS---RHGATAEARQIARGVEQGGFEARVRTVP----------AVSTEALYATLEDLKNCAG
3edoB           -KKTLILYYSWS--GETKKAEKINSEIKDSELKEVKVSEGTFDADYKTSDIALDQIEIQLDNIDYNNYDL
2amjB           SSNILIINGA--NGQLNDTLTEVADGTLRDLGHDVRIVRADSDY------------DVKAEVQNFLWADV
2a5lA           -PYILVLYYS---RHGATAEARQIARGVEQGGFEARVRTVPAVS-----------TALYATLEDLKNCAG
2arkA           AGKVLVIYDTGNTKKAELVAE----GARSLEGTEVRLKHVDEATKE-----------------DVLWADG
2arkB           AGKVLVIYDTGNTKKAELVAE----GARSLEGTEVRLKHVDEATKE-----------------DVLWADG
3d7nA           -SNTVVVYHS---GYGHTHRAEAVAEGAEATLHAIDAEGN----------------LSEDGWAALDAADA
1aktA           --KALIVYGS--TTGNTEYTAETIARELADAGYEVDSRDA----------------ASVEAGGLFEGFDL


                         .         .         *         .         .         .         .:140
query           IVLIAPIWNFRMPAIVEGWIDKVLSPPWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSPRLAVTTFFLN
1d4aA           VIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAA-----MYDKGPFRSKKAVLSITTGGSGSMYSLQGIH
2b3dB           VIWQMPGWWMGAPWTVKKYIDDVFTEGHGTLYASDPSKKYGSGGLVQGKKYMLSLTWNTEKDQFFHGVGV
2b3dA           VIWQMPGWWMGAPWTVKKYIDDVFTEGHGTLYAKDPSKKYGSGGLVQGKKYMLSLTWNAP-MEAFTEKDQ
2d5iA           IVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTEN-----GPEGLVTGKKAIVITSGGIHKDGPTDLVT-
2amjC           VIW--QPGWWGAPWTVKKYIDDVFTEGHGTLYA---SDKKYGSGGLVQGKKYLSLTWNAPEAFTEKDVGV
3brcB           LQFNTNWADLTRPAVTKALALDISGADLVIAR--------GRLGVPGSGSLLVIDSRGRLSPPHVIHSEV
2amjA           VIW--QPGWWGAPWTVKKYIDDVFTEGHGTLYASDGRKYG--SGGLVQGKKYLSLTWNAPKDQFFHGVGV
1dxqA           VIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNV
2amjD           VIW--QPGWWGAPWTVKKYIDDVFTEGHGTLYASK-----YGSGGLVQGKKYLSLTWNAPKDQFFHGVGV
3b6iA           IIFGTPTRFGNMSGQMRTFLDQTGGL--------------WASGALYGKLASVFSSTGT-----------
3b6mB           IIFGTPTRFGNMSGQMRTFLDQTGGL--------------WASGALYGKLASVFSSTGTEQTITSTWHHG
3b6mA           IIFGTPTRFGNMSGQMRTFLDQTGGL--------------WASGALYGKLASVFSSTGT-----------
3brcA           LQFNTNWADLTRPAVTKALALDISGADLVIAR--------GRLGVPGSGSLLVIDSRGRL----------
3edoA           ILIGSPVWSGYPATPIKTLLDQK---------------------NYRGEVASFFTSAGTN----------
2a5lB           LALGSPTRFG-NASPLKYFLDGTSSL--------------WLTGSLVGKPAAVFTSTASLHGGQETTQLS
3edoB           ILIGSPVWSGYPATPIKTLLDQK---------------------NYRGEVASFFTSAGTN----------
2amjB           VIW--QPGWWGAPWTVKKYIDDVFTEGHGTLYASDGR-TKYGSGGLVQGKKYLSLTWNAPEAFTEKDQFF
2a5lA           LALGSPTR-FGNASPLKYFLDG-TSSLWL-------------TGSLVGKPAAVFTSTASL----------
2arkA           LAVGSPTNG-LVSWKKRFFDDV-LGDLW---------------GEIDGKIACAFSSSGGWGGNEVACSIL
2arkB           LAVGSPTNG-LVSWKKRFFDDV-LGDLW---------------GEIDGKIACAFSSSGG-----------
3d7nA           IIFGTPTYG-GPSWQFKKFADASSKPWFS--------------AKWQDKVFGGFTNSASLNGDKLNTLQY
1aktA           VLLGCSTWNDDSIELQDDFIPL-FDSLEET--------------GAQGRKVACFGCGDSS----------


                         +         .         .         .         .         *         .:210
query           LPIRRLKRGVFHMCGIYNIVYRRYFAVPFVTDEKRKEFLEDVKKTANNI
1d4aA           GDMNVIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI
2b3dB           DGVYLPFHKANQFLGM--EPLPTFIANDVIKMPDVPRYTEEYRKHLVEI
2b3dA           FFVYLPFHKANQFLGMEPLPTFIANDVIKMPDVPRY-------------
2d5iA           ----PYLSTFLGFIGITDVKFVFAEGIAYGPE-----------------
2amjC           DGVYLPFHKANQFLGEPLPTFIANDVIKPDVPRYTEEYRKHLVEIF---
3brcB           REAVRSETHALERIGF---------------------------------
2amjA           DGVYLPFHKANQFLGEPLPT----FIANDVIKPDVPRYTEEYRKHLVEI
1dxqA           ILWPIQSGILRFCGFQVLEPQLVY-SIGHTPPDARMQILEGWKK-----
2amjD           DGVYLPFHKANQFLGEPL--------PTFIANDVIKPDVPRYTEEY---
3b6iA           -------------------------------------------------
3b6mB           MVIVAAQEGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLA---
3b6mA           -------------------------------------------------
3brcA           -------------------------------------------------
3edoA           -------------------------------------------------
2a5lB           L-LPLLHHGL--VLGIPYSEPTPYGASHFAGADGKRSLDEHELTLC---
3edoB           -------------------------------------------------
2amjB           HGVGVDGHKANQFLGEPLPTFIANDVIKPDVPRYTEEYRKHLVE-----
2a5lA           -------------------------------------------------
2arkA           T----LNFGFLVFGVTDYVGKKFHYGAVVAGEPRSEEEKEACRRLGRRL
2arkB           -------------------------------------------------
3d7nA           L------VLLAGQHGG-LWVSLGYIAPAQSESVGDLETARLYGA-----
1aktA           -------------------------------------------------