[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for pubi0:AAZ22091.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bfjA.bssp"
#ERROR : Can't open dsspfile "2bi4A.bssp"
#ERROR : Can't open dsspfile "1dqsB.bssp"
#ERROR : Can't open dsspfile "1dqsA.bssp"
#ERROR : Can't open dsspfile "2d2xB.bssp"
#ERROR : Can't open dsspfile "2d2xA.bssp"
#ERROR : Can't open dsspfile "3ce9A.bssp"
#ERROR : Can't open dsspfile "3ce9B.bssp"
#ERROR : Can't open dsspfile "3clhA.bssp"
#ERROR : Can't open dsspfile "2b98B.bssp"
#ERROR : Can't open dsspfile "2b99B.bssp"

## Summary of PDB Search
:388
    2e-66  32%  3bfjA  [x.x.x] 1,3-PROPANEDIOL OXIDOREDUCTASE
    6e-64  29%  2bi4A  [x.x.x] LACTALDEHYDE REDUCTASE
    8e-54  11%  1dqsB  [e.22.1] PROTEIN (3-DEHYDROQUINATE SYNTHASE)
    7e-53  14%  1dqsA  [e.22.1] PROTEIN (3-DEHYDROQUINATE SYNTHASE)
    3e-50  12%  2d2xB  [x.x.x] 2-DEOXY-SCYLLO-INOSOSE SYNTHASE
    4e-50  11%  2d2xA  [x.x.x] 2-DEOXY-SCYLLO-INOSOSE SYNTHASE
    1e-47  15%  3ce9A  [x.x.x] GLYCEROL DEHYDROGENASE
    7e-45  15%  3ce9B  [x.x.x] GLYCEROL DEHYDROGENASE
    9e-38  14%  3clhA  [x.x.x] 3-DEHYDROQUINATE SYNTHASE
    3e-11  14%  2b98B  [x.x.x] RIBOFLAVIN SYNTHASE
    3e-11  17%  2b99B  [x.x.x] RIBOFLAVIN SYNTHASE
:388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xQKYNWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXX
3bfjA           -RMFDYLVPNVNFFGPNAISVVGERCQLLGGKKALLVTDKGLRKDGAVDKTLHYLREAGIEVAIFDGVEP
2bi4A           --------NETAWFGRGAVGALTDEVKRRGYQKALIVTDKTLVQCGVVAKVTDKMDAAGLAWAIYDGVVP
1dqsB           --KISILGRESIIADFGLWRNYVALISDCSSTTYVLVTDTNIGSIY-TPSFEEAFRKRAAEITPSPRLLI
1dqsA           --KISILGRESIIADFGLWRNYVALISDCSSTTYVLVTDTNIGS-IYTPSFEEAFRKRAALIYNRPPGEV
2d2xB           ------DRCFNFAFGEHVLESVESYIPRDEFDQYIMISDSGVPDSIVHYAAEYFGKLAPVHILRFQGGEE
2d2xA           ------DRCFNFAFGEHVLESVESYIPRDEFDQYIMISDSGVPDSIVHYAAEYFGKLAPVHILRFQGGEE
3ce9A           ---HRIAIPLILEVGNNKIYNIGQIIKKGNFKRVSLYFGEGIYE--LFGETIEKSIKSSNIEIEAVETVK
3ce9B           ---HRIAIPLILEVGNNKIYNIGQIIKKGNFKRVSLYFGEGIYE--LFGETIEKSIKSSNIEIEAVETVK
3clhA           -------------LKEKNYVFLGELPEIKLKQKALIISDSIVAG-LHLPYLLERLKALEVRVCVIESGEK
2b98B           --------------------------------KKVGIVDTTFARVDMASIAIKKLKELSPNIKIIRKTVP
2b99B           --------------------------------KKVGIVDTTFARVDMASIAIKKLKELSPNIKIIRKTVP


                         .         .         *         .         .         .         .:140
query           XXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIA
3bfjA           NPKDTNVRDGLAVFRREQCDIIVTVGGGSPHDCGKGIGIAATHEGDLYQYAGIETLTNPL-----PPIVA
2bi4A           NPTITVVKEGLGVFQNSGADYLIAIGGGSPQDTCKAIGIISNNPEFADVRSLEG---LSPTNKPSVPILA
1dqsB           YNRP----PGEVSKSRQTKADIEDWMLSQNPPCGRDTVVIALGGGVIGDLTGFVASTYM----RGVRYVQ
1dqsA           SKSRQTKADIEDWMLSQNPTVVIALGGGVIGDLTGFVASTYMRGVRY---------------------VQ
2d2xB           YKTLSTVTNLQERAIALGRTAIVAVGGGLTGNVAGVAAGMMFRGIA-------------------LIHVP
2d2xA           YKTLSTVTNLQERAIALGATAIVAVGGGLTGNVAGVAAGMMFRGIALIH-------------------VP
3ce9A           NIDFDEIGTNAFK-IPAEVDALIGIGGGKAIDAVKYAFLRK------------------------LPFIS
3ce9B           NIDFDEIGTNAFK-IPAEVDALIGIGGGKAIDAVKYAFLRK------------------------LPFIS
3clhA           YKNFHSLERILNNAFEMQLSLMIALGGGVISDMVGFASSIYFRGIDF---------------------IN
2b98B           GIKDLPV-ACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLM------------TNKHIIE
2b99B           GIKDLPV-ACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLM---------TNKHIIEVFV


                         +         .         .         .         .         *         .:210
query           VPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEAYCA
3bfjA           VNTTAGTASEVTRHCVLTNTETKVKFVIVSWRNLPSVSINDPLLMIGKPAALTAATGMDALTHAVEAYIS
2bi4A           IPTTAGTAAEVTINYVITDEEKRRKFVCVDPHDIPQVAFIDADMMDGMPPALKAATGVDALTHAIEGYIT
1dqsB           VPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIWQPT-KIYIDLEFLETLPVREFINGMAEVIKTAAISS-E
1dqsA           VPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIW-QPTKIYIDLEFLETLPVREFINGMAEVIKTAAISS-E
2d2xB           TTFLAASDSVLSIKQAVNLTSGKNLVGFYYP---PRFVFADTRILSESPPRQVKAGMCELVKNMLILE--
2d2xA           TTFLAASDSVLSIKQAVNLTSGKNLVGFYYP---PRFVFADTRILSESPPRQVKAGMCELVKNMLILKEF
3ce9A           VPTSTSNDGFSSPVASLLINGKRTS----VPAKTPDGIVVDIDVIKGSPEKFIYSGIGDLVSNITALYEE
3ce9B           VPTSTSNDGFSSPVASLLINGKRTS----VPAKTPDGIVVDIDVIKGSPEKFIYSGIGDLVSNYDWKFEE
3clhA           IPTTLLAQVDASVGGKTGINTPYGKNLI-GSFHQPKAVYMDLAFLKTLEKREFQAGVAEIIKMAVCFDKN
2b98B           VFVHEDEAKDDKELDWLAKRRAEEHAENV-YYLLFKPEYLTRM---------------------------
2b99B           HEDEAKDDKELDWLAKRRAEEHAENYLLFKPEY------LTRMAGKGL----------------------


                         .         .         .         +         .         .         .:280
query           PGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTAFQKGLGAIHSLSHPVNALNNIH
3bfjA           KDANPVTDAAAMQAIRLIARNLRQAVALGSNLQAREYMAYASLLAGMAFNNNLGYVHAMAHQLGGLYDMP
2bi4A           RGAWALTDALHIKAIEIIAGALRGSVAG--DKDAGEEMALGQYVAGMGFSNGLGLVHGMAHPLGAFYNTP
1dqsB           EEFTALEENTILKAVRRTEEILKARI----LASARHKAYVVSADEREGGRNLLNWGHSIGHAIEAILTPQ
1dqsA           EEFTALEENTILKAVRRRFEGTEEILKARILASARHKAYVVSADEREGGRNLLNWGHSIGHAIEAILTPQ
2d2xB           NDNKEFTEDDLNSANVYSPKQLETFI----NFCISAKMSVLSEDIYEKKGLIFEYGHTIGHAIELAGGIT
2d2xA           --TEDDLNSANVYSPKQLETFINFCISAKMSVLSEDIYEKKKGL-------IFEYGHTIGHALAEQGGIT
3ce9A           ENHKSIIDDFAVISKKSVNSFVRTDFKSIKDEVFLKELVDSLTNGIAEISPASGAEHLISHALDKFLPNP
3ce9B           ENHKSIIDDFAVISKKSVNSFVRTDFKSIKDEVFLKELVDSLTNGIAESSPASGAEHLISHALDKFLPNP
3clhA           LVERLETKDLK---------------------DCLEEVIFQSVNIKAQVRAGLNYGHTFGHAIEKETDYE
2b98B           ----------------------------------------------------------------------
2b99B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           HGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDID
3bfjA           HGVANAVLLPHVARYNLIANPEKFADIAELMGENITAAEKAIAAITRLSMDIGIPQHLRDLVKET--DFP
2bi4A           HGVANAILLPHVMRYNADFTGEKYRDIARVMGVKVEARNAAVEAVFALNRDVGIPPHLRDVGVRKE-DIP
1dqsB           ILHGECVAIGMVKEAELARHLGILK-------------GVAVSRIVKCLAAYGLPTSLKDAIRKLTAGDQ
1dqsA           ILHGECVAIGMVKEAE-------------LARHLGILKGVAVSRIVKCLAAYGLPTSLKDAIRKLTAGDQ
2d2xB           HGEAIAVGMIYAAKIANRMNLMPHYWLLNKIGALQDDPDSIFHYLIEDNLGMILLSGVGKPAMYNQ-TLL
2d2xA           HGEAIAVGMIYAAKIAPEHDVSAHYWLLNKIGALQDIPLKFHYLIHEDNLGMILLSGVGKPMYNQTLLVR
3ce9A           QLHGIQVGVATYISKVHKHREERIKKIL---------------------SDTGFFNYVKGLNKKSD-FKR
3ce9B           QLHGIQVGVATYISKVHKHREERIKKIL---------------------SDTGFFNYVKGLNKKSD-FKR
3clhA           HGEAIAIGMRMANDLA---------------LSLGMLTLKEYERIENLLKKFDLIFHYKF-ILPKGVGAF
2b98B           ----------------------------------------------------------------------
2b99B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RLSKMALADPSTGGNPKKLTEDDMRIMYQNSMTGxxxx
3bfjA           YMAEMALKDGNAFSNPRKGNEQEIAAIFRQA-------
2bi4A           ALAQAALDDVCTGGNPREATLEDIVELYHTA-------
1dqsB           LMFNMALDKKNDGPKKKIVLLSAIGTPYETRASV----
1dqsA           LMFNMALDKKNDGPKKKIVLLSAIGTPYETRASV----
2d2xB           TPVRKTLIKE----------------------------
2d2xA           KTLIKEVIR-----------------------------
3ce9A           AISEAHLIPARYTYLHVEKNCETAKEIV----------
3ce9B           AISEAHLIPARYTYLHVEKNCETAKEIV----------
3clhA           EVASHIPKE-----------------------------
2b98B           --------------------------------------
2b99B           --------------------------------------