[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ20846.1

[Show Plain Result]


## Summary of Sequence Search
    1::304
   32::199     1e-28  44%  199 aa  PF07478 Dala_Dala_lig_C "D-ala D-ala ligase C-terminus"
    2::108     5e-10  46%  108 aa  PF01820 Dala_Dala_lig_N "D-ala D-ala ligase N-terminus"
   39::177     2e-08  32%  177 aa  PF08443 RimK "RimK-like ATP-grasp domain"
   31::162     1e-07  28%  164 aa  PF02655 ATP-grasp_3 "ATP-grasp domain"
    1::304

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxKILILSGGISKERLISLDTGKQVAKELIKNGYKVLISEPDKNLSKNITSFKPDVIFNALHGQFGEDG
PF07478         ----------------------------------------------------------------------
PF01820         ---KVAVLFGGRSSEREVSLVSATNVLAALDKDGYDVILGDPEEDLEADLPSVAPDVVFPALHGGYGEDG
PF08443         ----------------------------------------------------------------------
PF02655         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YIQAILETKKIPYTHSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFPVVV
PF07478         -----------------------------------------------------------------YPVFV
PF01820         TLQGLLELLGIPYTGS------------------------------------------------------
PF08443         -----------------------------------------------------------------FPVVI
PF02655         -----------------------------------------------------------------YPVVV


                         +         .         .         .         .         *         .:210
query           KPINEGSSVHVYICDKTNILKNLKVLKSYNEILIEEFIPGREIQVAIMNNKSLGAIELEPRRKFYDYEAK
PF07478         KPARGGSSVGVSVKNEEELEAALEEAFQYDKVLVEEFIKGREITVAVLGNKALPPGEIVPDGGFYDYEAK
PF01820         ----------------------------------------------------------------------
PF08443         KPLDGSQGRGVVLAETREELES--VLEAFRPILVQEFIPGRDIRVFVVGGKVVAAMKRQSAEG--DWRSN
PF02655         KPRDGAGSLGVRLVDNEEELEEAELLEASEPVLVQEFIEGPEYSVEVLSDGG-EALVLGVSRQRIGREPT


                         .         .         .         +         .         .         .:280
query           YNSSAKTKHLIPVDLSKNNLAKITGIARAAHKIIGCKGVTRSDFKFFNGKFYLLEINTQPGMTKLSLVPE
PF07478         YIDGGTT-YIIPADLPEEVEEKIRELALKAFRALGCRGLARVDFFLEDGEPYLLEVNTLPGMTPTSLYPK
PF01820         ----------------------------------------------------------------------
PF08443         LHRGGKAE---PVELTPEE----RELALKAAKALGL-GVAGVDLLRSNDGPLVLEVNSSPGLEGILLVED
PF02655         FVYTGAS---VPARLPERE--ELIELAERALEALGLRGPVGVDFILTDGGPYLIEINPRLG---------


                         .         *         .         .         .         .         +:350
query           IAKHKGISFIKLIEWILKxxxxxx
PF07478         AAEAAGISYSELIERLIE------
PF01820         ------------------------
PF08443         ------------------------
PF02655         ------------------------