[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ20908.1

[Show Plain Result]


## Summary of Sequence Search
    1::611
   14::156     3e-36  55%  156 aa  PF08459 UvrC_HhH_N "UvrC Helix-hairpin-helix N-terminal"
   17::211     1e-04  26%  631 aa  PF01496 V_ATPase_I "V-type ATPase 116kDa subunit family  "
    2::32      3e-04  45%   80 aa  PF01541 GIY-YIG "GIY-YIG catalytic domain"
    1::611

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAxxxxxxxxxxxxxxxxxx
PF08459         ----------------------------------------------------------------------
PF01496         ----------------------------------------------------------------------
PF01541         ---------------------PGVYIIYDKDGGVLYIGKANNLRRRLRQHLS------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08459         ----------------------------------------------------------------------
PF01496         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxQIRVCDDSTFKNRKRPCILYQIKRCSGPCVDYIDKEDYKKSVDQAIQFVSGKSRDI
PF08459         ----------------------------------------------------------------------
PF01496         --------------EVRRCDE---MERKLRYLEEEIKKLGIPLLEIDDLEEELEKLEEELRELNENLEKL
PF01541         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QKNLSKQMEEASEKLDFERASIFRDRIKSLNIIQSSQRINEANLIDADVIAAYKESGKTCIQVFFYRSKQ
PF08459         ----------------------------------------------------------------------
PF01496         KRNLNELTE---EKHVLEKAKEFLDEAEPLSSLDEDLEKLEQFLKLGFVAGVIPREKVEAFERILWRATR
PF01541         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NWGNQAYFPKHDPDQSLSEIMSSFLMQFYENKNVPKLIIINTEIEDKKLIEETxxxxxxxxxxxxxxxxx
PF08459         ----------------------------------------------------------------------
PF01496         GFLRQAEIPLEDPKKSVKKICESFGASLYESSGEPRLAELNTRIEDEKVLEAT-----------------
PF01541         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVEVYDNSHISGTNSVGAMITFGNE
PF08459         ----------------------------------------------IECFDISHIQGTDAVASMVVFEDG
PF01496         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GFVKKRYRKFDIKTKGNEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFG
PF08459         GPDKSEYRRFNIKTGG---DDYAAMREVLTRRFSR-LLKEGA--PLPDLILIDGGKGQLNAAREVLDELG
PF01496         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LHDLPMIAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAIxxxxxxxxxxxxxxxxx
PF08459         LDDIPVVGLAKGLERKAG--LLFLPGEKIILPRNSPALYLLQRIRDEAHRFAI-----------------
PF01496         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08459         ---------------------------------------------------
PF01496         ---------------------------------------------------
PF01541         ---------------------------------------------------