[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ20910.1

[Show Plain Result]


## Summary of Sequence Search
    1::293
    1::211     3e-29  35%  220 aa  PF01063 Aminotran_4 "Aminotransferase class IV"
    1::293

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFKLEEHTSRLFYSAKRMGIKI
PF01063         -------------------------------------------------YRLDEHLERLLRSAKRLLLP-


                         .         .         *         .         .         .         .:140
query           PYTEEEINLASKKIISVQGVKDGYVRPTIWRGSEMMAISAQQTKIHVAIATWEWGSYFDPKLKIEGIKLN
PF01063         PFDEEELLEALRELLAANPLGSGYIRPLLSRGGGGLGVSPPAEALFTVSPVGSYAALGSKPVKL----LL


                         +         .         .         .         .         *         .:210
query           ISNWRRPAPNTIPWDTKASGLYMICTLSKHEAEQQGYTDSLMLDHEGNVAEATGANIFFKDKNGEIHTPI
PF01063         SSDVRRAAPGGLLGGAKTGGRYANVLAAQREAKAAGYDEVLLLDEDGYVTEGSISNLFIV-KDGELVTPL


                         .         .         .         +         .         .         .:280
query           PDSFLDGITRRTVIEIAKSKGIKVNERKIAPAELSNFVGCFLTGTAAEVTPVSCIxxxxxxxxxxxxxxx
PF01063         SSGILPGITRQSLLELARDLGIEVEERDITVEELYEADEVFLTNTAAGVTPVGSI---------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxx
PF01063         -------------