[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ20943.1

[Show Plain Result]


## Summary of Sequence Search
    1::165
    3::131     7e-10  34%  132 aa  PF00430 ATP-synt_B "ATP synthase B/B' CF(0)"
    1::165

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxFWVAISFLIFIGALVYLKIPQKINELLNKLILDIKNEIDESEKLRQEAKVLLDNAQNKLDTAQT
PF00430         ------FWQLINFLILVGLLKKFLWPPLL-KALDERQKKIADELDEAEELREEAEELLAEAEAKLAEARA


                         .         .         *         .         .         .         .:140
query           VSNDILQQAKKDSDHLIIEMNDKFHKSSEIKKSLAENKISQMKEAALKEIKDVSIKIAVDSVKKIIxxxx
PF00430         EAAEIIEEAKKEAEAIKEEIKAEAEEEAERLKEQAEAEIEQEKERAIEELRQQVADLAVAIAEKIL----


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxx
PF00430         -------------------------