[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21022.1

[Show Plain Result]


## Summary of Sequence Search
    1::924
    1::360     e-105  52%  360 aa  PF00476 DNA_pol_A "DNA polymerase family A"
    1::165     2e-47  56%  165 aa  PF02739 5_3_exonuc_N "5'-3' exonuclease, N-terminal resolvase-like
    3::165     3e-26  44%  171 aa  PF01612 3_5_exonuc "3'-5' exonuclease"
    1::92      1e-23  55%  100 aa  PF01367 5_3_exonuc "5'-3' exonuclease, C-terminal SAM fold"
    1::924

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxDHFYLIDGSGYIFRAYYALPPLTRKSDGLPVGAVSGFCSMLFKLLEDSKSNENLQKPTHFAVI
PF00476         ----------------------------------------------------------------------
PF02739         -------DKLLLIDGSSLIFRAYYALPPLTN-SDGLPTNAVYGFLNMLLKLLKE-------EKPTHIAVA
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FDAARKTFRNEIYSDYKANRSEAPDDLAPQFEYIRKSVVAFNLPSVDLPNYEADDLIATYVEQILAKGAK
PF00476         ----------------------------------------------------------------------
PF02739         FDAGGKTFRHELYPDYKANRPPMPDELRPQLPLIRELLEALGIPVLEVEGYEADDVIGTLAKKAEKAGAP
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VTIVSSDKDLMQLYRKDVRIFDPMKNKFITPEDIVTKFxVGPEKVIDVQSLAGDSSDNVPGVPGIGVKTA
PF00476         ----------------------------------------------------------------------
PF02739         VVIVSGDKDLLQLVDDNVRVLDPMKNELYDPEGVIEKF--------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         ---------------------------------------VTPEQIIDYKALMGDSSDNIPGVPGIGEKTA


                         .         .         .         +         .         .         .:280
query           AELINKYGTLEKLLDNAQEIKQNKRRETLIENKDKAIISKKLVTLMKDAPVERKLEEFHLKxxxxxxxxx
PF00476         ----------------------------------------------------------------------
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         AKLLQEYGSLENLYANLDEIKGKKLREKLEENKEQARLSKELATIKTDVPLDLDLEDLRLK---------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxITNEKEIDEWINEAEEAGELAIDT
PF00476         ----------------------------------------------------------------------
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------VDTEEELEELLEKLKKAKVVAFDT
PF01367         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ETSSLDAHQTDLVGISLSTKIGQACYIPIGHKFKGCLKKETVIKKLKPLLEDKSVKKIGQNIKFDFIVLY
PF00476         ----------------------------------------------------------------------
PF02739         ----------------------------------------------------------------------
PF01612         ETTSLDP--AELVGCLIQLATGEACYLPDPL----ALGDDAVLAALKPLLEDPSILKVGHNAKFDLHVLA
PF01367         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KQGINMNSMEDTMLMSYVLDAGKNRHNMDTLSEIHLQHKTISFKEIVGTGKKEINFSDVELDKAMEYAAE
PF00476         ----------------------------------------------------------------------
PF02739         ----------------------------------------------------------------------
PF01612         NDGIELRGVFDTMLAAYLLDSGRRGHGLDALAERYLG----------VTLDKEEQASDWKTEEQIEYAAE
PF01367         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DADITYRLYKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEKKISKLEKEVF
PF00476         ----------------------------------------------------------EEKLDKL----I
PF02739         ----------------------------------------------------------------------
PF01612         DADVLLRLYE------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KISKKEFNIASPKQLGEIIYNDLKIAVLKKTRKGSFATNASVLEDLAFKGHEFPKLILDWRQVSKLKNTY
PF00476         ELAGEEFNLGSPKQLGEILFEKLGLP-LKKTKKG-YSTDEEVLEKLA-EDHPLIKLILEYRQLSKLKSTY
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SDALPEHINPNTKRVHTSFLLAATTTGRLASSDPNLQNIPIKSEDGKDIRKAFIAEKGFTLISADYNQIE
PF00476         VDKLPKLINKDG-RIHTSFNQTGTATGRLSSSDPNLQNIPSRTEEGREIRKAFVAPPGYKLVSADYSQIE
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           MRILADLAEVKELKKAFSNNEDIHSLTASQVFNVDIKKVDQDMRRKAKAINFGIIYGISQYGLAKQINVS
PF00476         LRILAHLSGDEALLEAFRTGEDIHTLTASKVFGVPLEEVTKELRRKAKAVNFGLIYGMGAFGLARQLGIS
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           NHEADEFLNAYFLKFPEIKIYMDNTIKFCRKSGYVTNIFGRRSHFNGINDKNFNVRNFQERAAINAPIQG
PF00476         REEAKELIDAYFERYPGVKKYMEDVVKEAREKGYVETLFGRRRYLPDINSRNRALRAAAERAAINAPIQG
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           SASEIMRLAMIRLNKKFESIKNNKSKILLQIHDELIFEVPVKEVKNITEIIKDEMTSVTESDLHTFSTPL
PF00476         SAADIIKLAMIRVDEALKE-EGLDARLLLQVHDELVFEVPEEEAEEVAKLVKEIMERAVE-----LSVPL
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           TVDVNTGDNWGIxx
PF00476         KVDVGVGKNWGL--
PF02739         --------------
PF01612         --------------
PF01367         --------------