[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21058.1

[Show Plain Result]


## Summary of Sequence Search
    1::967
    8::293     4e-51  44%  298 aa  PF00676 E1_dh "Dehydrogenase E1 component"
    3::170     6e-23  40%  172 aa  PF02779 Transket_pyr "Transketolase, pyrimidine binding domain"
   70::166     5e-04  32%  250 aa  PF05342 Peptidase_M26_N "M26 IgA1-specific Metallo-endopeptidase
    1::967

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00676         ----------------------------------------------------------------------
PF02779         ----------------------------------------------------------------------
PF05342         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00676         ----------------------------------------------------------------------
PF02779         ----------------------------------------------------------------------
PF05342         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00676         ----------------------------------------------------------------------
PF02779         ----------------------------------------------------------------------
PF05342         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxFEKFLHKKYVGTKRFGLDGGEGLIPALEQIIKIGGQAKVKEVKIGMSHR
PF00676         ---------------------FEDFLATKYQRQKRFGFEHGESGQEALQ--VGIAAALRPGDVVIGM-YR
PF02779         ----------------------------------------------------------------------
PF05342         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GRLNVLANVLQKSYKRIFNEFAGDIQTSGEEGAGDVKYHLGASSNREFDGNSVHVSLTDNPSHLEAVNPV
PF00676         GHLNVLANGLGP--KEIFAEFFG--KATDVKGKGGSMH--GFSSDKE-----VNFLGANGPSGLQI--PV
PF02779         ----------------------------------------------------------------------
PF05342         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLGQTRAKQFFHKDKERNKVIPILIHGDAAFAGQGVVTECFAMSGLPGHNTGGTIHIIVNNQIGFTTSPR
PF00676         AAGAARARKLKGKD-----VVVVAVHGDGA-AGQGVVYEALNLAGLWGLPV---IFVVENNQYGISTPPE
PF02779         ----------------------------------------------------------------------
PF05342         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FARSSPYPSDVAKMVDAPILHVNGDDPEAVVYATRIATEFRLKFNRDVVVDLICYRRFGHNEGDEPSFTQ
PF00676         RQRSSPYITDRAKGYGIPGFHVDGDDPEAVYAATKLAVEYRRKGKGPVLIELVTYRRGGHSESDDPSFYR
PF02779         ----------------------------------------------------------------------
PF05342         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PLMYKKIRSHPTPVEMYGKKLVNENTLSESELSKFKTDFKNLLDDQYKNAKDxxxxxxxxxxxxxxxxxx
PF00676         PEEYEEIRKHRDPIKRYAKKLIEEGVLTEEELEAIEKEVRAEVEEAVEFAEE------------------
PF02779         ----------------------------------------------------------------------
PF05342         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIDWSTAEALAFGSLLEEG
PF00676         ----------------------------------------------------------------------
PF02779         ----------------------------------------------------IAWRKAEGLALAELAEED
PF05342         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           YPVRLVGQDSGRGTFSQRHSVLRNQEDNSRYIPLNNISKNQMRYEIVDSFLSELAVLGFEYGYSLVEPNT
PF00676         ----------------------------------------------------------------------
PF02779         PEVVVGGADLAGGTFTHRHGLLHPFGEG----------------RVIDSGIAEQGMVGFAAGLAL---EG
PF05342         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LTIWEAQFGDFANGAQVVIDQFIASGERKWTRASGLVMLLPHGYEGQGPEHSSARLERFLQLCANDNLQV
PF00676         ----------------------------------------------------------------------
PF02779         LPPWEATFGDFLN--QIRADAAIRSYEALWKLPVPVVTRLPIGYGGDGPTHHSAEDEAFLRLIP--GLKV
PF05342         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LNCTTPANYYHALRRQMHREFRKPLIIMTPKSLLRxxxxxxxxxxxxxxxxxxxxxxxxxxDEENGFIKL
PF00676         ----------------------------------------------------------------------
PF02779         VRPSDPAEAFHLLRRAIRDD--GPVVLREPRQLLR-----------------------------------
PF05342         -------------------------------------------------------------DLSNYFLKV


                         +         .         .         .         .         *         .:910
query           KESSKIKKVILCSGKVYFDLLEAREKLKKDDVVLYRIEQLYPFPVKSLVREIKKYAKNANFYWCQEEPKN
PF00676         ----------------------------------------------------------------------
PF02779         ----------------------------------------------------------------------
PF05342         K-SSDFKDVYLPVSSI--------EEVTKDGKPVYKITASAPNLVQE---EDNKYSNNYTFYLEKPKPSE


                         .         .         .         +         .         .         .:980
query           MGAWFSVRDYIQWTLETINANNTGISYIGRSPDAxxxxxxxxxxxxxxxxxxxxxxx
PF00676         ---------------------------------------------------------
PF02779         ---------------------------------------------------------
PF05342         NNVYTSFKNLV----DAMNSNPSGTFKLGADLDA-----------------------