[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21098.1

[Show Plain Result]


## Summary of Sequence Search
    1::422
    7::139     1e-07  25%  139 aa  PF01565 FAD_binding_4 "FAD binding domain "
    1::422

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxPEDELQVSNLVQELYKKNQPTEIIGTGSKNFIGNNIQSAKKLSMSKLSGVIEYL
PF01565         ----------------PRSEEEVAAVVKAAREHGLPVVPRGGGHSLLGGAVVRGGVVIDLSRLNGILEVD


                         .         .         *         .         .         .         .:140
query           PEELYIKVKANTPXXXXXXXXXXXXXXXAFEPIDFGFIENGKSNKGTIAGHLACNFAGSRRFKVGSLRDH
PF01565         PDGLTVTVEAGVTLGDLYAALAPHGLLLPVDP--------GSGIPGTVGGAVAGNGGGPGSLRYGLTRDN


                         +         .         .         .         .         *         .:210
query           ILGFRGVNGKGDIIKSGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01565         VLGLEVVLADGEIVTAG-----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01565         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01565         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01565         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xx
PF01565         --