[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21175.1

[Show Plain Result]


## Summary of Sequence Search
    1::264
    1::157     5e-22  42%  178 aa  PF01656 CbiA "CobQ/CobB/MinD/ParA nucleotide binding domain"
    1::197     9e-07  29%  197 aa  PF07015 VirC1 "VirC1 protein"
    9::48      6e-06  48%  248 aa  PF02374 ArsA_ATPase "Anion-transporting ATPase"
    2::38      7e-05  49%   62 aa  PF09140 MipZ "ATPase MipZ"
    1::40      5e-04  42%  242 aa  PF06564 YhjQ "YhjQ protein"
   11::38      8e-04  57%  196 aa  PF00448 SRP54 "SRP54-type protein, GTPase domain"
    1::264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQIISIINQKGGVGKTTTVINLAAGLAQHEKKVLVIDLDPQGNATTGLGLSNLEGSTDTIYGVLNGTRVI
PF01656         ----AVTSGKGGVGKTTTAANLAAALARRGKRVLLIDADPQGS------LSSL----------LGGLKDL
PF07015         MNVIAFASGKGGAGKTTAAVNLASALAARGARVGLIDADPNRPLARWAENALRSGTWDPLCEVYAAEEVL
PF02374         ---------KGGVGKTTVAAALAVALAERGKKVLLVSTDPAHSLADAFG---------------------
PF09140         --IIVVGSGKGGVGKSTVAVHLALALARQGAKVGLLDLD-------------------------------
PF06564         MAVLGLQGVRGGVGTTTLTAALAWALQRLGENVLVIDADP------------------------------
PF00448         -----------GVGKTTTIAKLAARLKKKGKKVLLVAAD-------------------------------


                         .         .         *         .         .         .         .:140
query           SDVIRKTEFKNLDIITSNVDLSGLEVETADDSMRAFILKRELTAYLNDSRATYDYVLIDCPPSLSLLTVM
PF01656         LDLLLQAEARSLEIL----DLVPL-LLLLEGGLREELLRKLLEEL---KRDRYDYVIIDTPPGLGVLTAN
PF07015         EDAYEDAELSGFDFVLVDTEGGASELNNADEALSTYRYVREL--LLSERRAIPTAVLLTRVPVARLTTSQ
PF02374         ----------------------------------------------------------------------
PF09140         ----------------------------------------------------------------------
PF06564         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ALVSSHSLLVPLQTEFFALEGLTQLMKTIERIKVNLNPELKIRGILLTMFDxxxxxxxxxxxxxxxxxxx
PF01656         ALAAADLVVVPVQPGPVSLRGLLRLLELLKEL------GLKILGVVLNRVD-------------------
PF07015         RAISEMLESLPLQTPMHERDAFAA-MKSRGGLANNLLP--------------------------------
PF02374         ----------------------------------------------------------------------
PF09140         ----------------------------------------------------------------------
PF06564         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01656         ------------------------------------------------------
PF07015         ------------------------------------------------------
PF02374         ------------------------------------------------------
PF09140         ------------------------------------------------------
PF06564         ------------------------------------------------------
PF00448         ------------------------------------------------------