[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21176.1

[Show Plain Result]


## Summary of Sequence Search
    1::282
   11::86      8e-15  46%   89 aa  PF02195 ParBc "ParB-like nuclease domain"
    1::47      9e-06  49%   84 aa  PF08535 KorB "KorB domain"
    1::282

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNKFQPRKTFDAESLQDLTNSIKERGIIQPIIVR
PF02195         -------------------------------------NPYNPRKD-DEEELEELAESIKERGLLQPIVVR
PF08535         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RSSEDNSKYEIIAGERRWLSAQKAGLHEVPVVITNIDDLKSLEFAIxxxxxxxxxxxxxxxxxxxxxxxE
PF02195         PIP--GGRYEIVDGHRRLRAAKLLGLEEVPAIVRDLDDEEALALAL------------------------
PF08535         ---------------------------------------------------------------------E


                         +         .         .         .         .         *         .:210
query           FSYDQEKVAQFIGKSRSHIANCLRLLNLPQAVLKLIQTQKLSAGHAxxxxxxxxxxxxxxxxxxxxxxxx
PF02195         ----------------------------------------------------------------------
PF08535         LGLTQEEIAKRLGKSRSYIANLLRLLKLPEEVQEMLEEGKLSDARA------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02195         ----------------------------------------------------------------------
PF08535         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xx
PF02195         --
PF08535         --