[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21179.1

[Show Plain Result]


## Summary of Sequence Search
    1::844
    1::586     3e-66  39%  593 aa  PF00133 tRNA-synt_1 "tRNA synthetases class I (I, L, M and V)"
    8::357     4e-26  38%  363 aa  PF09334 tRNA-synt_1g "tRNA synthetases class I (M)"
   24::131     3e-05  25%  300 aa  PF01406 tRNA-synt_1e "tRNA synthetases class I (C) catalytic
   28::59      7e-05  47%  350 aa  PF00750 tRNA-synt_1d "tRNA synthetases class I (R)"
    1::844

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxKWQKFWHKNKVFSSKLDKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGY
PF00133         -----------RWQKRWEENGIFEASARKGKPKFVIHDGPPYANGSLHIGHALNYTIKDIIARYKRMQGY
PF09334         ----------------------------------------PYANGKPHLGHAYTYIAADVLARYQRLRGY
PF01406         -----------------------------------------------HIGHARTYVVFDVLRRYLRDFGY
PF00750         ----------------------------------------PNPAKPLHVGHLRSAIIGDSLARLLEFAGY


                         .         .         *         .         .         .         .:140
query           NVLHPMGWDSFGMPAENAARQNNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFL
PF00133         NVLYPPGWDCHGLPIEDLGREEFREKREWAEEYIGEIREQLKRLGLSVDWDREYFTMDPNYEAAVQWVFV
PF09334         DVLFLTGTDEHGTPIELKAEKEGITPQELVDKYHAEFKELFKKFGIS--FDNFIRTTSPEHKELVQEIFL
PF01406         DVTYVRNITDVDDKIIKRAREEGESIRELAERYIAAFHEDMDALNV---LPPDVEPRATEHIPEIIEFIE
PF00750         DV--------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DLYDKGLVYRKENYVNWDPVDETVLANEQVVDGKGWRSGATVERKKLNQWFFNISKFSEDLLQGLDALEN
PF00133         KLYEKGLIYRGKRPVNWCPVCGTALAD------------AEVEYKEV-----------------------
PF09334         RLYENGDIYKGEYEQWYCPSDETFLPDRQVEGTCPARGGATLEGKEEEHYFFRLSKFQDRLLEWYESNPD
PF01406         KLIDKGFAYEADGDVYFD----------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           WPNKVKVMQKNWIGKSFGCEVEFKIESEKPIESIKCYTTRPDTLFGFSFLALSVDHPLAKYYEEDKEFQK
PF00133         --------------KSPSVYVKFPLADGDEV-YLVVWTTRPETLPGNTAVAV---HPDIEYVLEKDGEKL
PF09334         PPSRVNEIINNWL---------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FREECSKTGTTEESIASAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRDLDFA
PF00133         ILAEALVEKLAKKLLELADEKG--KDLVGIHPL-TGREIPVIAADYVTMDFGTGAVHIAPAHDEDDYEVG
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KKYNLKITPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGLKVPSQSIIKTIEFLEKNNLGTKKTNYRLK
PF00133         KRHGLPIINVV----DEDGRFTEEAGEFAGFEARKAIVEDLKLTDQWFVKVDKLKERALEAVEEVNWNLR
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DWGISRQRYWGCPIPIAYDENDQPIKIPRDMLPVKLPEIEKLSNTGNPLDSEDNWKFFILDGKKYRRETD
PF00133         DWCISRQRYWGTPIPVWYCE---------DGGEVLVGSVEELVAARVEEEGADAWDLLPKGGGELRRDTD
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           TLDTFVDSSWYFLRFCSPHNLDRGFTQEEANYWMPVDQYIGGVEHAILHLLYSRFFMQALSYKNDDFKLK
PF00133         VLDTWFDSSWPFATLGWP------FEREEFEYFYPADLYVEGSDQ------IRGWFASSLMLSTALFG-K
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EPFDGLFTQGMVCHETYKDQNNKWLSPDEVTSEDGKKFYKKDNPSEKIIVGPTESMSKSKKNTIDPENII
PF00133         APFKNVLTHGL------------------VLDEDGRK------------------MSKSLGNVVDPLDVI
PF09334         -------------------------------------------------------MSKSRGNVVDPDDLL
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           KNYGADSVRLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLNSKILDKIKNxxxxxxxxxxxxxxxxxx
PF00133         DKYGADALRLWLASSDP-----------------------------------------------------
PF09334         DRYGADALRYYLLREGPSDGDFSWED--------FVER---VNSDLANKLGN------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00133         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00133         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxx
PF00133         ----
PF09334         ----
PF01406         ----
PF00750         ----