[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21236.1

[Show Plain Result]


## Summary of Sequence Search
    1::462
   76::295     2e-19  30%  302 aa  PF00206 Lyase_1 "Lyase"
    1::462

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00206         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxDIHMNIEKRLFQIIGEEAGYVHTARSRNDQVITDFKMWTTSATKEINKNLDN
PF00206         ------------------DVNMNVNEVIAGQLVHPNDHVHLGQTSNDVVDTALRLALRDALELLLPALRA


                         +         .         .         .         .         *         .:210
query           IIKTILKISEKNIETIMPGFTHLKNAQAVSFAHYLMSYVEMFNRDKKRFTYNLESLSENPLGVAALTGTS
PF00206         LIDALAEKAEEHKDTPMLGRTHLQDAQPTTLGKEFAAWAAELLRDLERLEDALKRLLLGPLGGATGVGTG


                         .         .         .         +         .         .         .:280
query           FNIDRNFTSKKLGFKRPTNNSIDTVADRDFVLDFLYSASVCSMHISRIAEELIIWNSDGFNLITLSDKVV
PF00206         LNADPEFAERVTGLGVPAPNSFDQVADRDAIAELLGALARLATSLSKIANDIRLLASGEFGEVEEPFPAQ


                         .         *         .         .         .         .         +:350
query           TGSSIMPQKKNPDLLEYLRGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00206         PGSSIMPHKVNPVRSELIRG--------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00206         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00206         ------------------------------------------