[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21245.1

[Show Plain Result]


## Summary of Sequence Search
    1::299
    2::51      3e-06  44%  100 aa  PF02559 CarD_TRCF "CarD-like/TRCF domain"
   71::157     5e-05  34%  388 aa  PF05889 SLA_LP_auto_ag "Soluble liver antigen/liver pancreas
    1::299

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02559         ----------------------------------------------------------------------
PF05889         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYKVKDYVVYPKHGVGQITEFKKINIGGIDVET
PF02559         --------------------------------------FKPGDYVVHPNHGVGRIEGIETIEIGGEPREY
PF05889         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YVLKFEKDKANGMVPVNKQSHLRPLATINQVNKCISILKSKPKIKRSMWSRRAQEYEAKISSGKIYELAE
PF02559         YVLEYAFGDMKLYVPVDQ----------------------------------------------------
PF05889         -------------LPSCKSCFVVPMATGMSLTLCLLALRKRPKAKYVIWSRIDQK-----SCFKAIETAG


                         .         .         .         +         .         .         .:280
query           VVRDLNKGDDLMVDQSYSERQLFEKAYERILxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02559         ----------------------------------------------------------------------
PF05889         VVENVLEGDELVTDLDAIEAAIEELGADNIL---------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxx
PF02559         -------------------
PF05889         -------------------