[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21392.1

[Show Plain Result]


## Summary of Sequence Search
    1::312
    1::215     2e-15  32%  232 aa  PF01370 Epimerase "NAD dependent epimerase/dehydratase family"
    1::312

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxIFITGHKGLVGSAIYRKLKAKGYTNLLIADRKKLDLTNQXXXXXXXXXXXXXXXXXAAAKVGG
PF01370         -------ILVTGGAGFIGSHLVRRLLERGYVNLLLADERKGDLTDPDALDEALAGVKPDAVIHLAAQ-SG


                         .         .         *         .         .         .         .:140
query           IYYNLKYKADFITENLQIQTNLIHGAYKCGIKDLIFLGSSCVYPKNCKQPIKETYLLSGKLEETNDAYAI
PF01370         VGRSIDDPAEFIEVNVVGTLNLLEAARKAGVKRFVFASSAAVYGDPAGGPITEDTPL-GPL----SPYGA


                         +         .         .         .         .         *         .:210
query           AKIAGIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNSHFIPAXXXXXXXXXXXXXNTVILWGNGKAK
PF01370         SKLAAERLARAYARAYGLPVVILRPFNVYGPGG---------FPTGLIPLLIRRALGGKPLPVYGDGTQV


                         .         .         .         +         .         .         .:280
query           REVIHVDDIAEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01370         RDFIHVDDLARA----------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01370         --------------------------------