[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21400.1

[Show Plain Result]


## Summary of Sequence Search
    1::187
    1::130     1e-38  52%  141 aa  PF06242 DUF1013 "Protein of unknown function (DUF1013)"
    1::187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxVEVQGIADGEVAKGIMAYNPIISGQLTREEIELASKDENKELQI
PF06242         --------------------------LEVQGIADGEVAQGIKGLDPIANGQLTREEIERCEKDPNYRLKL


                         .         .         *         .         .         .         .:140
query           KNTDIEISTEDKKIKKYIPLSKRQDKPDSALWLIKHHSLLKDSQIAKLVGITKASVTAIKNKSYWNYNNL
PF06242         SESKVLVPESKRKGPRYTPVSRRQDRPDAILWLVRNHPELKDAQIAKLIGTTKSTIEAIRDRTHWNSANI


                         +         .         .         .         .         *         .:210
query           NPKDPVALGLFSQKDLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06242         KPRDPVTLGLCSQIDL-------------------------------