[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21405.1

[Show Plain Result]


## Summary of Sequence Search
    1::336
    1::328     2e-87  50%  329 aa  PF00274 Glycolytic "Fructose-bisphosphate aldolase class-I"
    1::336

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLNKIALKILSNGKGILAADESNGTMTKRLESVNVPSSPENRLLFRETLFSSSGMKDFIGGVILYDET
PF00274         ---LIETAKAIVAPGKGILAADESTGTIGKRLASIGVENTEENRRAYRELLFTTPGLGDYISGVILFEET


                         .         .         *         .         .         .         .:140
query           INQTSNLKQTIPELISESGAVPGIKVDTGAKILAGSHEEKITEGLDGLRERLKDYYKLGARFTKWRGVFN
PF00274         LYQKTDDGKPFVDLLKEKGIVPGIKVDKGLVPLAGTNGETTTQGLDGLAERCAQYYKDGARFAKWRAVLK


                         +         .         .         .         .         *         .:210
query           ISDKYPSKLSIHSNAHALARYSALVQECGMVPIVEPEVLMDGDHAAETCFNKTSEVIQKCFEELLLHKID
PF00274         ISDGTPSQLAIKENANVLARYASICQQNGLVPIVEPEVLIDGDHDIERCQYVTEKVLAAVYKALNDHHVY


                         .         .         .         +         .         .         .:280
query           LSGIILKPNMILAGTTSDKKISSEEVAKLTLKCLKENVPTDVPGIAFLSGGQTEVEATENLNLINKYNDT
PF00274         LEGTLLKPNMVTPGADCPKKASPEEVAEATVTALRRTVPPAVPGIVFLSGGQSEEEATANLNAMNKLLPK


                         .         *         .         .         .         .         +:350
query           NFIMTYSYGRALQQSALKFWSKDINNTSGTQKVFNHRANMCTLAAQGKWSKxxxxx
PF00274         PWALSFSYGRALQASALKAWGGKDENVKAAQEALLKRAKANSLAALGKYKE-----