[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21413.1

[Show Plain Result]


## Summary of Sequence Search
    1::241
    1::232     7e-46  45%  234 aa  PF01709 DUF28 "Domain of unknown function DUF28"
    1::241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxSKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRLRSAIQAAKSANMPKDNIERAI
PF01709         ----SKWANIKHKKAAQDAKRGKIFTKLGREITVAAKLGGPDPESNPRLRAAIEKAKKANMPKDNIERAI


                         .         .         *         .         .         .         .:140
query           AKSSVNSETNYENLRYEGFGPDKIAVIVEALTDNKNRTASNVRSIFVKSGGNLGTQGSASHNFNQLGXXX
PF01709         KKASGGLDENYEEIRYEGYGPGGVAVIVEALTDNRNRTAADVRSAFSKNGGNLGETGSVSYLFDRKGVIV


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXFELAIESGADECISNDEFHEIQCPMSEIYNVKKNLEKTIANFISTEIEWVPLNSVDVEK
PF01709         FEKEGVDEDDLLEAALEAGAEDVEEDDGSIEVYTEPTDFGAVRDALEEAGLEIESAELTMIPQNTVELDE


                         .         .         .         +         .         .         .:280
query           DKVXXXXXXXXXXXXXXXVQSVYSNxxxxxx
PF01709         EDAEKLEKLIDALEDLDDVQNVYTN------