[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21432.1

[Show Plain Result]


## Summary of Sequence Search
    1::637
    4::166     7e-17  38%  172 aa  PF02779 Transket_pyr "Transketolase, pyrimidine binding domain"
    5::90      6e-14  42%  122 aa  PF02780 Transketolase_C "Transketolase, C-terminal domain"
    3::257     2e-12  34%  275 aa  PF00456 Transketolase_N "Transketolase, thiamine diphosphate
   82::175     1e-09  37%  298 aa  PF00676 E1_dh "Dehydrogenase E1 component"
    2::108     6e-05  33%  139 aa  PF02775 TPP_enzyme_C "Thiamine pyrophosphate enzyme, C-terminal TPP
    1::637

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTPNDRL
PF02779         ----------------------------------------------------------------------
PF02780         ----------------------------------------------------------------------
PF00456         --------------------------LANAIRALAIDAVQKANGHPGSPMGAADIAYVLHFLRHNPKDRF
PF00676         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNKLN
PF02779         ----------------------------------------------------------------------
PF02780         ----------------------------------------------------------------------
PF00456         VLSAGHASYALLHLTGYLSELKNFRQGSKTPGHPEYGHTPGVEFTTGPLGQGISNAVGMALAEKLAARFN
PF00676         -------------------------KGGSMHGFS--SDKEVNFLGAGPSGLQIPVAAGAARARKLKGKDV
PF02775         ------------------------------AGDSGRPRSWLDSGGLGSMGYGLPAALGAA----LANPDR


                         +         .         .         .         .         *         .:210
query           NIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRETFKL
PF02779         ----------------------------------------------------------------------
PF02780         ----------------------------------------------------------------------
PF00456         RVYAFLGDGELMEGISWEAASLAGHLKDNLIVIYDDNLISIDGPVGAFTEDLEK----------------
PF00676         VVVAVHGDGAAGQGVVYEALNLAGLWGLPVIFVVENNQYGISTPPERQRS--------------------
PF02775         RVVAVIGDGAF--GMSLQELNTAVRYGLPIIVVLNNEGYGMTTPFGAKRYSGPDLLPNPDFAKLAEAY--


                         .         .         .         +         .         .         .:280
query           IVSAFSKRFSVKAGKAEDFLRSAVTGGTLFNSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIK
PF02779         ----------------------------------------------------------------------
PF02780         ----------------------------------------------------------------------
PF00456         ----------------------------RFEAYGWNVIKVVDGHDVDAIYAAIEEAK-AVTDKPTLIIAK
PF00676         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TQKGKGYSYAEKASDHYHGxxxxxxxxxxxxxxxxxxxAYTKVFANTLVKHAERDSKVVGVTAAMPGGTG
PF02779         --------------------------------------AWRKAEGLALAELAEEDPEVVVGGADLAGGTF
PF02780         ----------------------------------------------------------------------
PF00456         TIIGKG-SPNKEGTNKAHG---------------------------------------------------
PF00676         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           MDIFAKDFPKRMFDVGIAEQHAVTFAAGLATEGYKPYVAIYSTFLQRAYDQVVHDVAIQSLPVRFIIDRA
PF02779         THRHGLLHPGRVIDSGIAEQGMVGFAAGLALEGLPPWEATFGDFL----NQIRADAAIRSLPVPVVTRLP
PF02780         ----------------------------------------------------------------------
PF00456         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GLVGADGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRYPRxxxxxxxxxxxxx
PF02779         IGYGGDGPTHHSAEDEAFLRLIPGLKVVRPSDPAEAFHLLRRAIR-DDGPVVLREPR-------------
PF02780         ----------------------------------------------------------------------
PF00456         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxVIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIVDARFAKPLDQELILKCAREHEAMIT
PF02779         ----------------------------------------------------------------------
PF02780         --------VLREGADVTLIATGSEVELALEAAEELAEEGISAEVIDLRTVKPLDEELILELAKKTYRVVV
PF00456         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           VEEGSIGGFGSHVENLLSEKGIFDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02779         ----------------------------------------------------------------------
PF02780         VEEGVVGGIGAAVAAALAERG-FD----------------------------------------------
PF00456         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxx
PF02779         -------
PF02780         -------
PF00456         -------
PF00676         -------
PF02775         -------