[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21520.1

[Show Plain Result]


## Summary of Sequence Search
    1::794
  186::271     3e-09  33%  284 aa  PF03176 MMPL "MMPL family"
  138::297     2e-04  24%  480 aa  PF04437 RINT1_TIP1 "RINT-1 / TIP-1 family"
  316::452     9e-04  31% 1014 aa  PF00873 ACR_tran "AcrB/AcrD/AcrF family"
   50::240     6e-09  27%  284 aa  PF03176 MMPL "MMPL family"(query 153->356)
    1::794

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLLIEGDPDLEYLKEVTERYGSKEFLIL
PF03176         ----------------------------------------------------------------------
PF04437         -------------------------------------------LQVEKEFALERFKEILNAEDAWEIDYD
PF00873         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TYSPNEGMVTESSINNLLSLKYKIQSLDWVHSVITLLDIPLLNNSEAPLQERLESFKTLKDEGVDTERGF
PF03176         ----------------------------------------------------------------------
PF04437         DVDPDDLKPTKSAIRETITERYRLPSLSQRLRFLIDIQLPLLDQFHERLVSRLEAYESLTSEGVAGLERL
PF00873         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NEILNSPVFRNFVISEDGKTSGIIVYIKKDELKDIENKSAQEIEEYKDTLKKKNHENITQIREVIKTYGD
PF03176         ----------------------------------------------------------------------
PF04437         CKILNSANYLESVLEEWSEDVFFLQNESGNSLTDVASRTSSEGSIFDETISK------------------
PF00873         ----------------------------------------------------------------------
PF03176         ------------LVSKDGKAALITVTLDGDPGSD---EAAEAVDAIRDA-----------VAEALPPAGV


                         .         .         .         +         .         .         .:280
query           VGKIYLGGIPMITDDMMSFIKSDIIVFGLGVLLFIIATLWFIFRKLIWIIVPISSCFFSVLIMTGLLGLL
PF03176         ----------------------------------------------------------------------
PF04437         ----------------------------------------------------------------------
PF00873         -----------VTYDQSEFIRASIVVKTLLEAILLVVLVLFLFLGIVALAIPLSLLTFAVMYLFGFLNLL
PF03176         T--VYVTGPAAIAADLNDAIEDDLLLAELIALLLILLLLLLVFRSLVAPLLPLLTVLLSLLAALGLVLVL


                         .         *         .         .         .         .         +:350
query           GWKVTVISSNFIALMLILTMAMNIHMSTRFLQLREDFPNLDNLKIIIMTTSKMFWPIIYTVLTTICAFLS
PF03176         ----------------------------------------------------------------------
PF04437         ----------------------------------------------------------------------
PF00873         SLFALILAIGILVDDAIVVVE-NIH---RHLE-----EGLSPLEAAIKAAKEVGGPVIASTLTTIAVFLP
PF03176         AGGLGIGLSSFLAFVLLLGLGVDIFLVSRYRELAAGGDREEAVRRALRTTGR---AITFAALTVAIGFAA


                         .         .         .         .         *         .         .:420
query           LVFSGIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03176         ----------------------------------------------------------------------
PF04437         ----------------------------------------------------------------------
PF00873         LAFSGI----------------------------------------------------------------
PF03176         LLFSPI----------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03176         ----------------------------------------------------------------------
PF04437         ----------------------------------------------------------------------
PF00873         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03176         ----------------------------------------------------------------------
PF04437         ----------------------------------------------------------------------
PF00873         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03176         ----------------------------------------------------------------------
PF04437         ----------------------------------------------------------------------
PF00873         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03176         ----------------------------------------------------------------------
PF04437         ----------------------------------------------------------------------
PF00873         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxVDNSIHYIYRFKEEFLKIKDYNKTLKVCHSTVGVAILNTSITIVFGFSILVFSKFIPTIYFGVFTGLA
PF03176         --VDYAIFLVSRYREELAAGGDREEAVRRALRTTGRAITFAALTVAIGFAALLFSPIPFLRQLGLALAIG
PF04437         ----------------------------------------------------------------------
PF00873         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           MLLAMISVLTLLPSLILIxxxxxx
PF03176         VLLAALVVLTLLPALLVL------
PF04437         ------------------------
PF00873         ------------------------
PF03176         ------------------------