[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21535.1

[Show Plain Result]


## Summary of Sequence Search
    1::485
    3::305     4e-84  53%  305 aa  PF00883 Peptidase_M17 "Cytosol aminopeptidase family, catalytic
    1::485

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00883         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00883         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxARDLVSEPGNVLHPDEYAKRINTLKKFGLKINIYDEKKLK
PF00883         ------------------------------ARDLVNTPPNRMTPPRLAEAVELAKELGVKVEVLDEEELE


                         .         .         .         +         .         .         .:280
query           KLGMNALLGVGQGSIRGSYLVTMEWNGAKNNSNPLAFVGKGVCFDTGGYSLKPAKFMEDMTYDMAGSATV
PF00883         ELGMGLLLAVGRGSRHPPRLVVLEYKGEGEAKKPLALVGKGITFDTGGLSLKPGGGMAGMKRDMGGAAAV


                         .         *         .         .         .         .         +:350
query           VGLMKNLAIRKAKINAVGVVGLVENMVSGNAQRPGDIVKSYSGKTIEVLNTDAEGRLVLADALTFTEKKF
PF00883         LGAMKAVAELKLPVNVVGVLALVENMIGGNAYRPGDIITSRSGKTVEVGNTDAEGRLVLADALTYA-KEL


                         .         .         .         .         *         .         .:420
query           KPKFMVDLATLTGAIIVSLGSEYAGLFSNDDKLSKQLLEAGDKVEEKLWRMPLHKNFDKLIDSKNADMQN
PF00883         KPDLLIDVATLTGAAVVALGPDYAGVFSNDDELAQQLLAAGEQSGEPVWRLPLREEYREQLKSDVADLAN


                         .         .         +         .         .         .         .:490
query           INYVGGAGSTTAAQFLQRFILNKTPWAHLDIAGMAFSKYGGALNSGGATSYGVRLLNQxxxxxxx
PF00883         IGGRRGAGAITAAAFLKEFV-EDLPWAHLDIAGTAWNSGAGK----GATGRGVRTLVQ-------