[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21597.1

[Show Plain Result]


## Summary of Sequence Search
    1::281
    5::213     3e-39  43%  213 aa  PF01557 FAA_hydrolase "Fumarylacetoacetate (FAA) hydrolase family"
    1::281

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01557         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVIGKKAKRVLE
PF01557         ------GRNYAEHAKEVGREVPIEPVFFLKPASSVVGPGDPIRRPRGSEKLDYEVELAVVIGKPLRGVTE


                         +         .         .         .         .         *         .:210
query           KDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLVTKDEIQXXXXXXXXXXXXGHRHQT
PF01557         EDALDHIFGYTLANDVSARDWEKVPLG-WFAAKSFDGATPIGPWIVTPDALEDPRDLRLELRVNGEVVQR


                         .         .         .         +         .         .         .:280
query           GNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXXXXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVIxx
PF01557         GNTADMIFSPAQLIAHLSRGMTLRPGDL--ILTGTPSGVGGGPRVFLKPGDVVEIEIEGLGTLRNRVV--


                         .         *         .         .         .         .         +:350
query           x
PF01557         -